KEGG   Rattus norvegicus (rat): 298436Help
Entry
298436            CDS       T01003                                 

Gene name
Tspan1
Definition
(RefSeq) tetraspanin 1
  KO
K17348  tetraspanin-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    298436 (Tspan1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   298436 (Tspan1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin DUF2981
Motif
Other DBs
NCBI-GeneID: 298436
NCBI-ProteinID: NP_001004236
RGD: 1303308
Ensembl: ENSRNOG00000023320
UniProt: Q6AYR9
Position
5q35
AA seq 241 aa AA seqDB search
MQCFKFIKVMMILFNLLIFLCGAALLAVGIWVSVDGTSFLKAFGSLSSSAMQFVNVGYFL
IAAGAVLFILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTMAEQFLTF
LVVPAIEKDYGYQTEFTQVWNSTMEGLHCCGFNNYTDFNSSRFVKENKVFPPFCCANNTD
SHTVEPCTEDKAKSMNVQGCFKQILQKIRTNAVTVGGVAVGVAALELAAMVVSMYLYCNL
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcttcaaattcattaaggtcatgatgatcctcttcaatctactcatctttctc
tgtggtgcagccctgttggctgtgggaatctgggtgtccgtcgacgggacatctttcctg
aaggccttcggatcactatcatcgagtgccatgcagtttgtcaacgtgggctacttcctc
atcgccgctggtgctgtactctttattcttggtttcctgggctgctatggtgctcactcc
gagaacaagtgtgtgctcatgatgttcttttccattctcctcatcatcttcattgcggag
attgcaggggccgtggttgctttggtgtacaccacaatggctgaacaattcctgacattt
ctggtggtgcctgctatcgaaaaggactatggttaccagactgaattcacccaagtgtgg
aactctacgatggaggggctgcattgctgtggcttcaacaattacacagattttaactcc
tcacgtttcgtcaaagagaacaaagtctttcctccgttctgttgcgccaacaacactgac
agtcatacagttgaaccatgcaccgaggacaaggccaaaagtatgaatgtacagggttgt
ttcaaacagattctgcagaaaatcagaaccaatgcagttaccgtgggtggtgtggcagtt
ggagttgcggccctagagctggctgccatggtggtatccatgtatctatactgcaatctg
aagtaa

DBGET integrated database retrieval system