KEGG   Rattus norvegicus (rat): 298447Help
Entry
298447            CDS       T01003                                 

Gene name
Dmap1
Definition
(RefSeq) DNA methyltransferase 1-associated protein 1
  KO
K11324  DNA methyltransferase 1-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    298447 (Dmap1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     298447 (Dmap1)
    NuA4 complex
     298447 (Dmap1)
  Chromatin remodeling factors
   SRCAP complex
    298447 (Dmap1)
   SWR1 complex
    298447 (Dmap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DMAP1 SANT_DAMP1_like
Motif
Other DBs
NCBI-GeneID: 298447
NCBI-ProteinID: NP_001015006
RGD: 1311295
Ensembl: ENSRNOG00000019407
UniProt: Q568Y6
Position
5q36
AA seq 468 aa AA seqDB search
MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYAL
LYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEE
GKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDH
QQYKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAGHERRRKEQLERLYNRTPEQ
VAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAE
KPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEEL
VHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPAVGPTPASAE
PTVSESGLGLDPSKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctacgggcgcagatgtacgagacattctagaactcgggggtccagagggagatgcc
gcttctgggaccatcagcaaaaaggatattatcaacccggacaagaaaaagtccaagaag
tcctcagagacactgaccttcaagaggccggagggcatgcatcgggaggtctatgctttg
ctttactctgacaaaaaggacgcacccccactgcttcccagtgacaccggtcaggggtac
cggacagtgaaggctaagttggggtccaagaaggtccgaccttggaagtggatgccattt
accaacccagctcgaaaggatggtgctatgtttttccactggcgccgagcagcggaggag
ggcaaggactaccctttcgccaggttcaataagacagtacaggtgccggtgtactcagag
caggagtaccagctctaccttcacgatgatgcatggactaaggcagagactgaccatctc
tttgacctcagccgccgatttgatttgcgcttcgtagttattcacgatcggtatgaccac
cagcagtacaagaagcgttctgtggaggacctgaaagagaggtactaccacatttgtgct
aagcttgccaacgtgagggctgtgccaggtacagatctcaaaataccagtatttgatgct
ggacatgagagacggcggaaggaacagctggagagactttacaaccgaaccccagagcag
gtggcagaggaggagtacctgctccaggagcttcgtaagattgaggcccggaaaaaagag
cgggagaagcgcagccaagacctgcagaagctgattaccgcagcagacaccaccgcagag
cagcggcgcacagaacgcaaggctcccaagaagaagctaccccagaagaaggaggccgag
aagccggctgttcctgagactgcgggcatcaagttcccagactttaagtcagcgggtgtg
acattacggagccagcggatgaagctgcccagctctgtgggtcagaagaagatcaaggcg
ctggaacagatgctgctggaacttggtgtggagctgagccctacgcccacagaggagctg
gtgcatatgttcaatgagttgcggagtgacctggtgttactctacgagctcaagcaggcc
tgtgccaactgtgaatatgagctgcagatgctacggcaccggcatgaggctctggctcgg
gcaggagtgctggggggccctgccacaccagcagtgggaccaaccccagcgtctgctgag
ccaacagtgtctgaatctggacttggtcttgaccctagcaaggacaccatcattgatgtc
gtgggtgcaccgctcacacccaattcgcggaaacgacgggaatcagcctccagctcatct
tctgtgaagaaagccaagaaaccataa

DBGET integrated database retrieval system