KEGG   Rattus norvegicus (rat): 298504
Entry
298504            CDS       T01003                                 

Gene name
Mfsd2a, Mfsd2, RGD1310174
Definition
(RefSeq) major facilitator superfamily domain containing 2A
  KO
K23894  sodium-dependent lysophosphatidylcholine symporter 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    298504 (Mfsd2a)
Transporters [BR:rno02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   298504 (Mfsd2a)
SSDB
Motif
Pfam: MFS_2 MFS_1
Other DBs
NCBI-GeneID: 298504
NCBI-ProteinID: NP_001100153
RGD: 1310174
Ensembl: ENSRNOG00000014008
UniProt: B1WBW6
Position
5q36
AA seq 534 aa
MAKGEGAESGSAAGLLPTGILQASERPAQVKKEPKKKQQLSICNKLCYAVGGAPYQLTGC
ALGFFLQIYLLDVAKVEPLPASIILFVGRAWDAFTDPLVGFCISKSSWTRLGRLMPWIIF
STPLAIIAYFLIWFVPDFPSGTESSHGFLWYLLFYCLFETLVTCFHVPYSALTMFISTEQ
SERDSATAYRMTVEVLGTVIGTAIQGQIVGQAKAPCLQDQNGSAVASEVVNRTQSTASLK
ETQNAYLLAAGIIASIYVICAVILILGVREQREPYEAQQAESMPFFQGLRLVMSHGPYVK
LIAGFLFTSLAFMLVEGNFALFCTYTLGFRNEFQNLLLAIMLSATFTIPIWQWFLTRFGK
KTAVYVGISSAVPFLILVALMKSNLIVTYVVAIAAGVSVAAAFLLPWSMLPDVIDDFHLK
HPHSPGTEPIFFSFYVFFTKFASGVSLGVSTLSLDFAKYQTQGCSQPEEVKFTLKMLVTM
APIILILLGLLLFKLYPIDEEKRRQNKKALQALRDEASSSGCSDTDSTELASIL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggccaaaggagagggcgccgagagcggttccgcggcggggctgctccccaccggcatc
ctccaagccagcgaacgaccagcccaggtgaagaaggaaccaaaaaagaagcagcaactg
tccatttgcaataagctttgctatgcggttggaggggccccataccagttgaccggctgc
gcgctgggattcttcctgcagatctacctgttggatgtggctaaggtggagccactccct
gcttccattatccttttcgtgggccgagcgtgggatgccttcactgaccctctcgtgggc
ttctgcatcagcaagtcctcctggacccgcctgggccgcctcatgccctggatcatcttc
tccactcctctggccatcattgcttactttctcatctggtttgtgcctgacttcccatca
gggacagaaagttcgcacgggttcctttggtacctgcttttctattgcctctttgagaca
ctggtcacgtgcttccacgttccctactcagcgctcaccatgttcatcagtaccgagcag
agtgagcgtgactccgccactgcctataggatgactgtggaggttctgggcacagtgata
ggcacagcgatccaaggacaaattgtgggccaagccaaggcaccttgtctccaggaccag
aatggctctgcagtggcctcagaagttgtcaatcgtacccagagcactgcctccctcaaa
gaaacgcaaaatgcatacctgctggcagcagggatcatcgcctccatctacgtcatctgt
gccgtcattctgattttaggcgtgcgggagcagagagaaccctacgaggcccagcaggcc
gagtcaatgcccttctttcagggcctccggctggttatgagtcatggcccctatgtcaag
ctcattgccggcttcctttttacctccctggctttcatgctggtagaaggtaattttgcc
ttgttctgcacctacaccttgggcttccggaacgagttccagaacctcctcctggccatc
atgctctcggccacattcaccatccccatctggcaatggttcctaacccggtttggcaag
aagacggctgtatacgttgggatctcttctgcagttccttttctcatcttggtggccctc
atgaagagtaatctaatcgtcacttacgtggtggccatagcagctggtgtcagtgtagca
gctgccttcttactaccatggtccatgctgcctgatgttatcgatgacttccacctgaaa
caccctcactcccctggcacggagcccatcttcttctccttctatgtcttcttcaccaag
tttgcctctggagtctcactgggtgtctctaccctcagtctcgactttgctaagtaccag
acgcaggggtgctcccagccagaagaggtcaagtttacactgaagatgctggtgaccatg
gctcctatcatcctcatcctgctgggcctgctgctcttcaagctgtaccccattgatgag
gagaagcggcgacagaacaagaaagctctgcaggctttacgagatgaagccagcagctca
ggctgctcggatacagactccacagagctggccagcattctctag

DBGET integrated database retrieval system