KEGG   Rattus norvegicus (rat): 298506Help
Entry
298506            CDS       T01003                                 

Gene name
Mycl, Lmyc1, Mycl1
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog
  KO
K09110  L-myc proto-oncogene protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    298506 (Mycl)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    298506 (Mycl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N HLH DUF3287
Motif
Other DBs
NCBI-GeneID: 298506
NCBI-ProteinID: NP_001178692
RGD: 1588591
Ensembl: ENSRNOG00000014259
UniProt: G3V7T4
Position
5q36
AA seq 369 aa AA seqDB search
MDFDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGSGPGAVDPASGISP
GEPWPGGGAGDEAESRGHSKAWGRNYASIIRRDCMWSGFSARERLERVVSDRLAPGVPRG
NPPKAPATPDGTPSLEASNPAPATQCQLGEPKTQACSGSESPSDSEGEEIDVVTVEKRRS
LDIRKPVTITVRADPLDPCMKHFHISIHQQQHNYAARFPPESCSQEGDPEPGAQEEALEI
EAPKEKEEEEEEEEEEEEIVSPPPVENEAPQSCHPKPVSSDTEDVTKRKNHNFLERKRRN
DLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKKMATEKRQLRCRQQQLQ
KRIAYLSGY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgactcgtatcagcactatttctacgactatgactgcggagaggatttctac
cgctccacggcgcccagcgaggacatctggaagaaattcgagctggtgccgtcgcccccc
acgtcgccgccctggggctccggtcccggcgccgtggaccctgcctctgggattagtccc
ggggagccgtggccaggagggggtgccggggacgaggcggaatctcggggccattcgaaa
gcttggggcaggaattatgcttccatcattcgccgtgactgcatgtggagcggcttttct
gcccgggaacggctggagagagtggtgagcgacaggctggccccaggagtgccccggggg
aacccgcccaaagcgcccgctaccccggatggcactcctagtctggaagccagtaacccg
gcgcccgccacccagtgtcagctaggcgagcccaagactcaggcctgctccgggtccgag
agccccagcgattccgaaggcgaggagatcgacgtggtgacggtggagaagagacgatcc
ctggacatccgaaagccagtcaccatcacagtgcgagcagaccccctggacccctgcatg
aaacacttccatatctctatccaccaacagcagcacaactatgctgcccgttttcctcca
gagagctgctctcaagagggggatcctgagccaggtgcccaggaagaggctctggaaata
gaagctcccaaggagaaagaggaggaggaggaggaagaagaggaggaggaagagatagtg
agtcccccacctgtagaaaatgaggctcctcagtcctgccaccccaaacctgtcagttct
gacactgaggacgtgaccaagaggaagaaccataacttcttagaacgaaaaaggaggaat
gacctccgctcacggttcctggccctgcgggaccaggttcccaccctggccagctgctct
aaggcccccaaagtcgtgatcctaagcaaggcattagaatacttgcaggctttggtgggg
gctgaaaagaaaatggctacggagaaaaggcaactccggtgtcggcaacagcaactgcag
aaaagaatcgcgtacctcagtggctactaa

DBGET integrated database retrieval system