KEGG   Rattus norvegicus (rat): 298514Help
Entry
298514            CDS       T01003                                 

Gene name
Rragc
Definition
(RefSeq) Ras-related GTP binding C
  KO
K16186  Ras-related GTP-binding protein C/D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    298514 (Rragc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    298514 (Rragc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Arf Roc SRPRB Ras MMR_HSR1 AAA_14 AAA_16
Motif
Other DBs
NCBI-GeneID: 298514
NCBI-ProteinID: NP_001041649
RGD: 1311760
Ensembl: ENSRNOG00000017426
UniProt: Q0D2L6
Position
5q36
AA seq 398 aa AA seqDB search
MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAGGGGGAGAGGGCGPGGGDSSK
PRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQM
DFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVD
GLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLP
TLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGL
KEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRK
AIHEVFEVGVTSHRSCSHQTSAPSLKALAHNGTPRNAI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcaatacggggcggaggagacgcccctggccggcagttacggcgcagccgac
tcattccccaaggacttcggctacggcgtggaggaggaggaagaagaggcagcggcgggt
ggcggcggaggcgcgggggccggcggcggctgcggcccgggaggcggtgacagctccaag
ccaaggatcttgcttatgggactacggcgcagcggcaagtcctccattcagaaggtggtg
tttcataagatgtcacccaatgagactctctttttggaaagtaccaacaagatttataaa
gatgacatttccaacagctcctttgtcaacttccagatttgggattttcctgggcagatg
gacttcttcgacccaacctttgactatgaaatgatcttcagggggacaggagcattgata
tatgtcattgatgcacaggatgactacatggaggctttaactcgacttcacatcactgta
tctaaggcctacaaagtgaacccagacatgaactttgaggtttttattcacaaagttgat
ggtctgtctgatgatcacaagatagaaacacagagggacattcatcaaagggccaatgat
gacctggcagatgctgggctggaaaagctccatcttagcttttatttgactagcatctat
gaccactcaatatttgaagctttcagtaaggtggtacagaaactcatcccgcaactgccc
actttggaaaacctattaaatatctttatatcaaattcaggtattgaaaaagcttttctc
tttgatgttgtcagcaaaatctacattgcaacagacagctcccctgtggatatgcagtct
tacgagctctgctgtgacatgattgatgttgtaattgatgtgtcctgtatatatggatta
aaggaagatggaagtggaagtgcttatgacaaagaatcgatggccattatcaagctgaac
aatacaactgtcctttatttaaaggaagtcactaaatttttggcactggtttgcattctt
agggaagagagctttgaacgaaaaggtttgatagactacaacttccactgtttccgaaaa
gctatccatgaggtgtttgaggtgggtgtgacttctcacagaagctgtagtcatcagacc
agtgctccaagcctgaaagccttggcacacaatggcacacctcggaatgccatctag

DBGET integrated database retrieval system