KEGG   Rattus norvegicus (rat): 298521Help
Entry
298521            CDS       T01003                                 

Gene name
Grik3, GluK3, GluR7, gluR-7
Definition
(RefSeq) glutamate ionotropic receptor kainate type subunit 3
  KO
K05203  glutamate receptor, ionotropic kainate 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    298521 (Grik3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    298521 (Grik3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    298521 (Grik3)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   298521 (Grik3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 298521
NCBI-ProteinID: NP_001106187
RGD: 71027
Ensembl: ENSRNOG00000008992
UniProt: P42264
Structure
PDB: 

Position
5q36
AA seq 919 aa AA seqDB search
MTAPWRRLRSLVWEYWAGFLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNA
VQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQSLKWRSATVVYD
DSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQ
ILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWS
MERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFGG
RFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGVWSPADGLNITEVA
KGRGPNVTDSLTNRSLIVTTLLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFS
YEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
SILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPG
SEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAF
LTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVK
NNEEGIQRTLTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKIT
IAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAV
GEFIYKLRKTAEREQRSFCSTVADEIRFSLTCQRRLKHKPQPPMMVKTDAVINMHTFNDR
RLPGKDSMSCSTSLAPVFP
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccctggcggcgcctccggagtctggtttgggaatactgggccgggttcctc
gtgtgcgccttctggatcccagactcgcgcgggatgccccacgtcatccggatcggcgga
atctttgagtacgcggacggccccaacgcccaggtcatgaacgctgaggagcacgccttt
cggttttctgccaatatcatcaacaggaacagaactctgctgcccaacacgaccctgact
tacgacattcagaggattcacttccatgacagttttgaggccaccaagaaggcctgtgac
cagttggcgctcggtgtggtagccatctttgggccatcccagggctcctgcaccaatgcc
gtccagtccatctgcaatgccttggaggttcctcacatccaactgcgctggaagcaccac
cccctggacaacaaggacaccttctacgtgaacctctaccccgactacgcctctctcagc
cacgccatcctcgacttggtccagtccctcaagtggcggtcagccaccgtagtctatgat
gacagtacaggtctcatccggctgcaggagctcatcatggctccatctaggtacaacatc
cgcctgaagattcgccagctccccatcgactccgatgactcacgccccttgctcaaagag
atgaagcggggccgggagttccgtatcatctttgactgcagtcacaccatggcagcccag
atcctcaagcaggccatggccatgggcatgatgacggaatactaccacttcatcttcacc
actctggatctctatgcgctagacctggaaccctaccgctactcgggagtgaacctgact
gggttccgcatactcaacgtggacaacccccatgtctcagccattgtggagaagtggtcc
atggagcggctacaggcagctccccgggcagagtcaggcctgctggatggagtgatgatg
accgatgcagccctgctctacgatgcggtccacattgtgtctgtgtgctaccagcgagcg
ccgcagatgactgtgaactccctacagtgccatcggcacaaggcctggcgcttcggtggc
cgcttcatgaacttcatcaaggaggctcaatgggaaggattaactggacggattgttttc
aacaaaactagtggcttgcggactgattttgatctggacatcatcagcctcaaggaagat
ggcctcgagaaggtcggggtgtggagtccagctgacggtctcaatatcactgaggttgcc
aaaggccgaggtcctaatgtcaccgactctctgaccaacaggtcactcatcgtcaccact
ctgctggaggagccttttgtcatgttccgcaagtctgataggaccctttacggcaatgac
cggttcgagggctactgcatcgacttgctcaaggagctggcgcacatcctgggcttctcc
tacgagatccggctggtggaagacggcaagtacggggcacaggacgacaagggccagtgg
aacggcatggtcaaggaactcattgaccacaaagcagatctggctgtggctcccctgacc
atcacccatgtccgagagaaggccattgacttctctaagccttttatgaccctcggagtg
agcatcttatatcgaaaacccaatggcaccaaccccagtgtcttctccttcctcaacccc
ctgtccccagacatctggatgtacgtgctactcgcctacctgggtgtcagctgtgtcctc
ttcgtcattgccagattcagcccttatgaatggtatgatgcccacccctgcaaccccggc
tctgaggtggtggagaataacttcacgctgctcaacagcttctggtttggaatgggctcc
ctgatgcaacaaggatctgaactgatgcccaaagctctgtctacccgcatcattggcggc
atctggtggttcttcacccttattatcatctcctcctacacggccaacctggctgccttc
ctgaccgtggagcgcatggagtcacccatcgactctgccgatgacctggccaagcagacc
aaaatagagtacggtgctgtcaaggatggggccaccatgaccttcttcaagaaatccaag
atctccacctttgagaagatgtgggccttcatgagcagcaagccctcggctctggtgaag
aacaatgaggagggcatccagcggacactcacagctgactacgctctgctcatggagtcc
acgaccatagagtacatcacacaaaggaactgcaatctcacccagatcggcggcctcatc
gattccaagggctacggcatcggcacgcccatgggctccccctacagggacaaaatcacc
atcgccattctgcagctgcaggaggaggacaagctgcacatcatgaaggagaagtggtgg
cgaggcagcgggtgccccgaggaggagaacaaggaggccagcgcactgggcatccagaag
attggcggcatcttcatcgtcctggctgccggcttagtcctgtccgtgttggtggcagtg
ggcgagtttatatacaaactccgcaagacagcggaacgggagcagcgctctttctgcagc
acagtggccgacgagatccgcttctccctcacctgccagcggcgtctcaagcacaagcca
cagcctcctatgatggtcaagacagatgcggttatcaacatgcacacctttaatgaccga
aggcttccaggcaaggacagcatgagctgcagcacctcgctagcccctgtcttcccttag

DBGET integrated database retrieval system