KEGG   Rattus norvegicus (rat): 298532Help
Entry
298532            CDS       T01003                                 

Gene name
Tekt2
Definition
(RefSeq) tektin 2
  KO
K18629  tektin-2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    298532 (Tekt2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     298532 (Tekt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tektin DUF1192
Motif
Other DBs
NCBI-GeneID: 298532
NCBI-ProteinID: NP_001011977
RGD: 1311065
Ensembl: ENSRNOG00000011033
UniProt: Q6AYM2
Position
5q36
AA seq 430 aa AA seqDB search
MATLSLKPSQRYRLSDWLTNSYLLSTNAERQRDASHQIRQEARILRNETNNQTVWDEHDN
RTRLAERIDTVNRWKEMLDKCLTDLDAEIDSLTQAKESVEQSLQAKNLPLDVAIECLTLR
ESRRDIDVVKDPVEEELMKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKM
ETLEIDRGCLSLNLTAPNLSLKVNPTRVPKDSTTLQEWDDFTRFNKNRADTEMKASIELR
ETIALAIAQTNNELEAQRVATEFTFRKRLREMESLYSELKWQEKNTLEEIAELQADIRRL
EEDLRRKMMNLKLAHTRLESRTYRPNVELCRDQTQYGLIDEVHQLEATISIMKQKLAQTQ
DALDALFKHLARIQADIACKTNTMLLDTKCMDIRRKLTVPAEKFVPQVDTFTRTTNRTLS
PLKTCQLELN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctacactaagtctcaagcctagccaacgctatcggctctccgactggctcaccaac
agctacctgttgtccaccaatgcggagcggcagcgagatgcttcccaccagatccgccag
gaggcccggatccttcgcaatgagaccaacaaccagactgtgtgggatgaacatgacaat
aggactcgcctcgccgagaggatcgatactgtcaatcgatggaaggagatgctggacaag
tgtctaacagatttagacgctgagatcgacagcttgacacaggcgaaagagtcagtggag
caaagcctgcaggccaagaacctgcccctggatgtggccatcgagtgtctgactctgcgg
gagagtcggcgagacattgatgtggtgaaagacccggtggaggaagagctgatgaaagag
gtggaagtcattgaagccaccaagaaggtcctacaggagaagatcagccaggccttccag
cacctctgcctcctgcaggaaatccggcaacagctcaactctgaccaccgggacaaaatg
gagacactggaaattgataggggctgcctctctctcaacctcacggccccaaacctctct
ctgaaggtcaaccccacacgagtccccaaagactccaccacactgcaggagtgggatgac
ttcactcgattcaacaagaaccgtgcagacacggaaatgaaagcatctatagagttgagg
gaaaccattgccctagctatcgctcagaccaacaatgaactggaagctcagagggttgcg
acagaatttaccttcaggaagcggcttcgggagatggaaagtttgtacagtgagctcaag
tggcaagagaaaaatactttagaagagatagccgagctgcaggcagacattcggcgcctg
gaggaggacctgcgtagaaagatgatgaacttgaagcttgcacatacccgcctggaatcc
agaacctaccggcccaatgtggaactctgccgggaccagacccagtatggcctcattgat
gaagtccaccagctggaggcaaccattagtatcatgaagcagaaacttgcgcagacacag
gatgctctggatgccctgttcaagcacctggcccggattcaggctgatattgcgtgcaag
accaacaccatgctcttggacaccaagtgtatggacatccgacgcaagctgaccgtgccg
gctgagaaatttgtgccccaggtggacaccttcacgcgcacgacaaaccgcacactgagt
ccactcaaaacctgccagctggagctaaactag

DBGET integrated database retrieval system