KEGG   Rattus norvegicus (rat): 298549Help
Entry
298549            CDS       T01003                                 

Gene name
Mtfr1l, Fam54b, RGD1305453
Definition
(RefSeq) mitochondrial fission regulator 1-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_fiss_reg
Motif
Other DBs
NCBI-GeneID: 298549
NCBI-ProteinID: NP_001013957
RGD: 1305453
Ensembl: ENSRNOG00000016937
UniProt: Q5XII9
Position
5q36
AA seq 289 aa AA seqDB search
MEANVTIPIWQNKPHGAARSVVRRIGTNLPLKPCPRASFETLPNISDLCLKDVPPVPTLA
DIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALP
ALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSSGSSNVSSPLPCFGSSFHSTTS
FVISDITEETEVEVPELPTIPLLCSASPECCKSEHKTTCSSSEEDDCISLSKASSFADMM
GILKDFHRIKQSQDLSRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaatgtgactatcccaatctggcagaacaagccacatggggctgctcgcagt
gtggtaagaagaattgggaccaatctgcccctgaaaccttgtccacgggcatcctttgag
accctgcccaacatctctgacctgtgtttgaaagatgtgcctccagtcccgactctggct
gacatcgcctggattgccgcagatgaagaggagacatatgctcgggtcaggagcgataca
cgccctctgagacatacctggaagcccagccctctgattgtcatgcaacggaatgcctca
gtgcccaatctgcgtgggtctgaggagaggctcctggccctgaagaagccagccctgcct
gccctaagccgcaccactgagctgcaggatgaactaagccacctgcgcagccagattgct
aaaatagtggcagcagatgcagcttcggcctcattaacgccagatttcttatcttcagga
agttcaaatgtctcctctcctttgccttgctttggatcctcattccactctacaacttcc
tttgtcattagtgacatcactgaggagactgaggttgaggtccccgagcttccaacaatc
cccctgctttgttctgccagccctgaatgttgcaaatcagaacacaaaactacctgcagc
tcgtctgaagaggatgactgcatctctctgtccaaggccagcagctttgcagacatgatg
ggcatcctgaaggattttcatcggataaaacagagccaagacctgagccggagtttactg
aaggaagaagaccctgctgtccttatctctgaggtccttaggaggaagtttgccctgaag
gaagaagacatcagtagaaaaggaaactga

DBGET integrated database retrieval system