KEGG   Rattus norvegicus (rat): 298573Help
Entry
298573            CDS       T01003                                 

Gene name
Eif4g3
Definition
(RefSeq) eukaryotic translation initiation factor 4 gamma, 3
  KO
K03260  translation initiation factor 4G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    298573 (Eif4g3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    298573 (Eif4g3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298573 (Eif4g3)
   03012 Translation factors [BR:rno03012]
    298573 (Eif4g3)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     298573 (Eif4g3)
   mRNA cycle factors
    Stress granule specific factors
     298573 (Eif4g3)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    298573 (Eif4g3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIF4G MA3 W2 PP_kinase
Motif
Other DBs
NCBI-GeneID: 298573
NCBI-ProteinID: NP_001100163
RGD: 1311370
Ensembl: ENSRNOG00000014368
UniProt: D4A554
Position
5q36
AA seq 1583 aa AA seqDB search
MNSQPQARSPPSRAVPVHCPDNWKRRKVLEQTPVYRSLAGRGWIKYCIFFQRPQIQPPRA
AIPNSSPSLRPGAQTPTAVYQANQHIMMVNHLPMPYPVPQGPQYCIPQYRHSGPPYVGPP
QQYPVQPPGPGPFYPGPGPGDFANAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTI
RIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTPPQQLPSQAPEHSPVVYGTVESA
HLAASTPVTAASDQKQEEKPKPDPVFQSPSTVLRLVLSGEKKEQAGQIPETAAGEPSPEP
PRTSSPTTLPPLARSSLPSPMSAALSSQQLLTAEDKCELSSSKDDAPPVRSPTSCTAAPG
PSLTDDIGLCKKPCGVAPPDGQLVSSPVLINEMNGVGEKLPAKENTVDMVRQEVLPLTLE
LEILEHPQEERKVECTPTPITPSTMPSFSPAPPTPPASPPCTPVVLSATIARSPAVATVI
QRVVDEGESLRTCLSKDAKETQDKAEAESDGQTEETADPQNAHAGRSPAPVQTATTAPKT
WKKTKERTRTPDEVLEAEAEPKAEEELSVDSVLEPEQEKMSQGFQFERDPSTLKRAKAEE
ENGEEAEPVRNGAESASEGEGGDANSGSTDSSGDGVTFPFKAESWKPADTEGKKQYDREF
LLDIQFMPACIQKPEGLPPISDVVLDKINQPRLPMRTLDPRILPRGPDFTPAFADFGRQT
PGGRGVPLLSVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHADDPES
IKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVA
YANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAP
EERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLEC
LCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRR
ADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLD
PSKFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRSSASSLNRFSPLQPPA
PSGSPSATPLDFDSRRALTSRGSMGREKSDKPLPAGTARPNTFLRGSSKDLLDNQSQEEQ
RREMLETVKQLTGGVDAERASTEADRSKARELVKSEVCTVPAPDKPALSEEEVERKSKSI
IDEFLHINDFKEATQCIEELSAQGPLHVFVKVGVEFTLERSQITRDHMGHLLYQLVQSEK
LSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKEGGISMRELIVEFSKPLLPV
GRAGVLLSEILHLLCRQMKLDFTESEGPCSSEALSKKELSAEELSQRLEKLIMEDKADDE
RIFDWVEANLDESQMSSPTFLRALMTAVCKAAIVADCSTFRVDTAVIKQRVPILLKYLDS
DTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNGKG
VALKSVTAFFTWLREAEEESEDN
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atgaattcacaacctcaggcccggtctccgcccagcagagcagtgccagtacactgccca
gacaactggaagaggaggaaggttttggaacagactcccgtttacaggtccctggctgga
agaggctggataaaatactgcatttttttccagaggcctcaaatccagcctcccagagcg
gccatcccaaacagcagtccttccctccgtcctggtgcgcagacccccaccgccgtgtat
caggccaatcagcacatcatgatggttaaccatctgcctatgccatacccagtgccccag
gggcctcagtactgcataccacagtaccgccacagtggccctccgtatgtggggccccca
cagcagtacccagttcagccacccggccccgggcctttttatcctggaccaggacctggg
gactttgctaatgcttatggaacgcctttttacccaagtcagccagtgtatcagtcagca
cctatcatagtgcctacgcagcagcagccccctccagccaagagagagaaaaaaactata
cgaattcgagatccaaatcagggaggtaaagacataaccgaggagattatgtctggaggt
ggcagcagaaatcccactccacctataggaagacccacatccacacccactcctcctcag
cagctgcccagccaggcccctgagcacagccctgtggtatatgggactgtggagagcgct
catcttgctgccagcacccctgtcactgcagctagcgaccagaagcaagaagaaaagcca
aaaccagacccagtgttccagtctccttcaacagtccttaggctcgtgcttagtggggag
aagaaagagcaagcaggccagatacccgagactgctgcaggagagcccagcccagagcct
cctcggacctcatcacccaccacccttcctccacttgcccggagttcactcccttccccc
atgtccgctgcccttagcagccagcagctgctcactgctgaggacaagtgtgaactctct
tcctcaaaagatgatgccccccctgtgcgcagccccacgtcttgcacagcagcaccaggc
ccttcactaacagatgacattggtctatgcaagaaaccctgtggtgtagcacctcctgac
ggccagctcgtttctagtcctgtcctaattaatgaaatgaacggagttggtgagaaatta
ccagccaaggagaacactgtggacatggtgagacaggaagtgttgccactgactcttgaa
ctggagattctggagcatccccaggaagaaaggaaagtggagtgtaccccgactcccatc
accccgtccacgatgccttccttctccccagcccctccaactccgccagcttctcctcct
tgtactcctgttgtcctgtctgccaccattgctcgatctcctgctgttgccactgtgatc
cagagagttgtcgacgagggagagagcctgagaacttgtcttagcaaggatgccaaggag
acacaggacaaagcggaggcagagtcagatgggcaaacagaggagactgcggatccccag
aacgcacatgcaggaaggagccctgccccagtgcaaacagctaccactgcgccaaagacg
tggaagaaaacaaaagagcggacccgaaccccagatgaagtgttagaagcagaggcagag
cctaaagcagaagaagagctttcagttgacagtgtccttgaacctgagcaagagaagatg
agccaagggtttcagtttgagagagacccctctaccctgaaaagagcgaaagctgaggaa
gaaaacggagaagaagcagagcctgtgcgcaatggtgctgagagtgcttccgagggggaa
ggaggagacgctaattcaggctctaccgatagctctggagatggggtcacattcccattt
aaagcagagtcctggaaacctgcagatacagaaggcaagaagcaatatgaccgggagttc
ctattggacatccagtttatgcctgcctgtatccaaaaaccagaaggcctacctcccatc
agcgatgtggttcttgacaagatcaaccagcccagattgccaatgcggaccctggatcct
cgaattttgcctcgaggacctgatttcaccccagcctttgcagattttggaagacagacg
cctggtggaagaggcgtgcctttgttgagtgttggacctcggaggtctcaacctggccag
agaagggagcccaggaagataattactgtctccgtaaaagaagacgtgcacttgagaaag
gcagagaatgcctggaagcccagccagaagcgggacagccatgccgatgaccccgaaagc
attaaaacgcaggaacttttcagaaaagttcgaagtatcctaaataaactgacaccacag
atgttcaaccagctgatgaagcaagtgtcggcacttaccgtggacacagaggagcggcta
aagggggtcatcgacctggtctttgagaaggctatcgatgagcccagcttctctgtggcg
tacgcaaacatgtgtcggtgcctagtaacgctgaaggtacctatggcagacaagcccggt
aacacagtaaatttccggaagctgctgcttaatcgttgccagaaggagtttgaaaaggat
aaagcagatgatgacgtctttgagaagaagcagaaagaactggaagctgccagtgctcca
gaggaaagaacgaggcttcacgatgaactggaagaagccaaggacaaagcccggcggaga
tccatcggcaacatcaagttcattggagagctctttaaactcaaaatgctgacggaggcc
atcatgcatgattgtgtggtgaagctgctaaagaaccatgatgaggaatccctggagtgc
ctgtgtcgcctgctcaccaccatcggcaaagacctggactttgagaaagcaaagccgcgc
atggaccagtactttaaccagatggagaaaattgtcaaagaaaggaaaacttcctcccgg
attcggttcatgcttcaggatgtaattgacctcaggctgtgtaattgggtgtcccgaaga
gcagatcaggggccaaagactatcgagcagattcacaaagaggccaaaatagaagaacaa
gaggagcaaaggaaagtccagcagctgatgaccaaggagaagagaagaccaggcgtccaa
agagtggatgaaggtggatggaatactgtacaaggggccaagaacagtcgtgtactggac
ccctccaaatttttgaaaatcactaagcccaccattgacgagaagattcagctggttcct
aaggcacagctgggcagctggggcaaaggcagcagtggtggagcaaaggcaagcgagact
gacgccttacggtcaagtgcttccagtttaaatagattctctcctctgcaacctccagcg
ccttcagggtccccgtcagccacgcctttagacttcgattcccggagggcgttaaccagt
cgtgggagcatgggcagggagaagagcgacaagccgcttccagctggaacagcccgtccc
aacacgttcctgaggggcagcagcaaagacctgctggacaaccagtctcaggaagagcag
cgcagagagatgctggagacggtgaagcagctgacaggaggcgtggacgccgagcgggcc
agcactgaggccgaccgaagcaaagcgagggagctagtcaagtcagaagtgtgcacagtg
ccagcccccgacaagcctgcactgtcagaagaggaagtagagaggaagtccaagtctatc
attgacgagttcctgcacatcaatgactttaaggaggccacacagtgcatagaggagctg
agtgcccagggcccactgcatgtgttcgtgaaggtgggtgtggagttcaccctggagcgg
agccagatcaccagagatcacatgggccacttactgtatcagctggtgcagtcggaaaag
ctcagcaagcaggactttttcaaaggcttttctgaaaccttggagttggcagatgacatg
gccattgacatcccccatatttggttgtacctggctgaactagtcacccccatgttaaaa
gaagggggaatctccatgagagaacttattgtggaattcagcaagccattacttcctgtt
ggtagagctggggtcctgctttccgaaatcctgcaccttctatgcagacaaatgaagttg
gacttcacggagtcagagggaccctgctcctctgaagcactttcaaagaaagaattgtct
gctgaggagctgtctcagcgcctggagaaactgatcatggaggacaaagcagatgacgag
cggatctttgactgggtggaggccaatctagacgaaagccagatgagttcgcccacattc
cttagagctttaatgacggccgtttgcaaagcagccattgtcgccgactgttctaccttc
agagtggacactgctgtgatcaagcagagagtgccgatcttactcaagtacctggactca
gacacagagaaggagctgcaagcactttatgcactacaagcatcaatagtgaaacttgac
caacctgccaatttgctccggatgttttttgattgcctgtatgatgaggaggtgatatca
gaggatgccttctacaaatgggagagcagcaaggaccctgctgaacaaaacgggaagggc
gtagccctcaaatctgtcacagcgtttttcacgtggcttcgggaagcagaagaggagtcg
gaggataactaa

DBGET integrated database retrieval system