KEGG   Rattus norvegicus (rat): 298584
Entry
298584            CDS       T01003                                 

Gene name
Capzb
Definition
(RefSeq) F-actin-capping protein subunit beta
  KO
K10365  capping protein (actin filament) muscle Z-line, beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    298584 (Capzb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    298584 (Capzb)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    298584 (Capzb)
   04147 Exosome [BR:rno04147]
    298584 (Capzb)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    298584 (Capzb)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     298584 (Capzb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   298584 (Capzb)
SSDB
Motif
Pfam: F_actin_cap_B
Other DBs
NCBI-GeneID: 298584
NCBI-ProteinID: NP_001005903
RGD: 1359099
Ensembl: ENSRNOG00000007330
UniProt: Q5XI32
Position
5
AA seq 272 aa
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQC
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagcgatcagcagctggactgcgccttggacctgatgaggcgcctgcctccacagcag
attgagaaaaacctcagcgatctgatcgacctggtccccagtctgtgtgaagatctcctg
tcttctgttgaccagcccctgaaaattgccagagacaaggtggtgggcaaggactacctt
ttgtgtgactacaacagagacggggactcctataggtcaccatggagtaacaagtatgac
cctcctttggaagatggggccatgccatctgctcggctcagaaagctggaggtagaggcc
aacaatgccttcgaccaataccgagacctgtattttgaaggtggtgtctcatcagtctac
ctctgggatctcgatcatggctttgctggagtgatcctcataaagaaggctggggatgga
tcaaagaagatcaaaggctgctgggattccatccacgtggtggaagtgcaggagaagtcc
agtggccgtactgcccattacaagttgacctccacagtgatgctatggctgcaaaccaac
aaatccggctcaggcaccatgaacctgggaggcagcctaaccagacagatggagaaggac
gaaactgtgagtgactgttccccacacatagccaacattgggcgcctggtggaggacatg
gaaaacaaaatcagaagcacgctgaatgagatctactttggaaaaacaaaggacatcgtc
aacgggctgaggtctgtgcagacgtttgcagacaaatcaaagcaggaagcccttaagaat
gacctggtggaagccttgaagagaaagcagcagtgttaa

DBGET integrated database retrieval system