KEGG   Rattus norvegicus (rat): 298598Help
Entry
298598            CDS       T01003                                 

Gene name
Necap2
Definition
(RefSeq) NECAP endocytosis associated 2
  KO
K20069  adaptin ear-binding coat-associated protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    298598 (Necap2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    298598 (Necap2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1681
Motif
Other DBs
NCBI-GeneID: 298598
NCBI-ProteinID: NP_954527
RGD: 735063
Ensembl: ENSRNOG00000008427
UniProt: Q6P756
Position
5q36
AA seq 241 aa AA seqDB search
MSTASRRGPPTVVTGPQNGNWTSHPGVAGCGSLRKGRWPTSSWRTGPLAPVDQFPGTAVE
SVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNP
DEGPKLDLGFKEGQTIKINIANMRKKEGAAGAPRTRPASAGGLSLLPPPPGGKMSTLIPP
SGEQLSGGSLVQPVSGSGGATELWPQSKPAAAATADIWGDFTKSTGSPSSQSQPGTGWVQ
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgcatcccgccgcgggccaccaaccgtggttacagggcctcagaatggcaac
tggaccagccatcctggagtggccggctgcggatcactgcgaaagggaaggtggcctaca
tcaagctggaggacaggacctctggccccagtggaccagtttcccggcaccgctgtggag
agtgtgacagactccagcaggtacttcgttatccgaattgaagatggaaacgggcgacgt
gcttttattgggattggctttggggaccgaggggacgcctttgacttcaacgtggcattg
caggaccatttcaagtgggtgaagcagcagtgcgagtttgcaaaacaagctcagaaccca
gatgaaggccccaagttggacctgggcttcaaggagggccagaccatcaagatcaacatc
gcaaacatgagaaagaaggaaggagcagctggggccccaagaaccaggcctgccagcgca
ggagggctgagcctgctgccccctcctccagggggcaagatgtctacactcatccctccc
tctggagagcagttgtctgggggctctctggttcagccagtttctggttcaggaggtgcc
acagaactctggccacaatctaagcctgctgccgctgccactgctgatatctggggcgac
ttcaccaagtccacagggtccccctccagccagtctcagccaggcactggctgggtccag
ttttga

DBGET integrated database retrieval system