KEGG   Rattus norvegicus (rat): 298648
Entry
298648            CDS       T01003                                 

Gene name
Tardbp
Definition
(RefSeq) TAR DNA-binding protein 43
  KO
K23600  TAR DNA-binding protein 43
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    298648 (Tardbp)
   03015 mRNA surveillance pathway
    298648 (Tardbp)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    298648 (Tardbp)
   05022 Pathways of neurodegeneration - multiple diseases
    298648 (Tardbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    298648 (Tardbp)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     298648 (Tardbp)
SSDB
Motif
Pfam: TDP43_N RRM_1 RRM_7 RL RRM_3 RRM_5
Other DBs
NCBI-GeneID: 298648
NCBI-ProteinID: NP_001011979
RGD: 1310906
Ensembl: ENSRNOG00000012455
UniProt: I6L9G6
Position
5
AA seq 285 aa
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDEADASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGKSPFGRS
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtctgaatatattcgggtaacagaagatgagaatgatgagcccattgaaataccatca
gaagacgatgggacagtgttgctgtccacagttacagcccagtttccaggggcgtgtggc
ctgcgctaccggaatccagtgtctcagtgtatgagaggtgtccgactggtggaaggaatt
ctgcatgccccagatgctggctggggcaatctggtctatgttgtcaactatcccaaagat
aacaaaaggaaaatggatgaggcggatgcttcctctgcagtgaaagtgaaaagagcagtc
cagaagacatctgacctcatagtgttgggtctcccctggaaaacaacagagcaggaccta
aaagactacttcagtacttttggagaggttcttatggttcaggtcaagaaagatcttaaa
actggtcactcaaaagggtttggctttgttcgatttacggaatatgaaactcaagtgaaa
gtaatgtcacagcgacatatgatagatgggcgatggtgtgactgtaaacttccaaattct
aagcaaagcccagacgagcctttgagaagcagaaaggtgtttgttggacgttgtacagag
gacatgactgctgaagagcttcagcagttcttctgtcagtatggagaagtggtagatgtc
ttcattcccaaaccattcagagcttttgcctttgttacctttgcagatgataaggttgcc
cagtctctttgtggagaggacttgatcattaaaggaatcagcgtgcatatatccaatgct
gaacctaagcataatagcaatagacagttagaaagaagtggaagatttggtggaaaatct
ccatttgggagatcatga

DBGET integrated database retrieval system