KEGG   Rattus norvegicus (rat): 298652Help
Entry
298652            CDS       T01003                                 

Gene name
Ube4b, ufd2a
Definition
(RefSeq) ubiquitination factor E4B
  KO
K10597  ubiquitin conjugation factor E4 B [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    298652 (Ube4b)
   04120 Ubiquitin mediated proteolysis
    298652 (Ube4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    298652 (Ube4b)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     298652 (Ube4b)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  U-box type E3
   298652 (Ube4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ufd2P_core U-box DUF4568
Motif
Other DBs
NCBI-GeneID: 298652
NCBI-ProteinID: NP_001258127
RGD: 1304738
Ensembl: ENSRNOG00000014986
UniProt: F1M8V2
Position
5q36
AA seq 1173 aa AA seqDB search
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASVPGPSQSLGLNVHNT
TPATSPIGAAGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIATAARSPD
RNLMLNTGSSSGTSPMFCSLGSFSASSLSSLGASGGASTWDSYSDHFTIETCKETDMLNY
LIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLV
PYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLARAAKECSLDSDYFKYPLMALG
ELCETKFGKTHPMCNLVASLPLWLPKSLSPGSGRELQRLSYLGAFFSFSVFAEDDAKVVE
KYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSYMAAIVNANM
KKAQMQADDRLVSTDGFMLNLLWVLQQLSTKIKLETVDPTYIFHPRCRITLPNDETRINA
TMEDVNEWLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRLRAIRELNRT
VEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFLRRCLNFYGL
LIQLMLRVLDPAYPDITLPLNSEVPKVFAALPEFYVEDVAEFLFFIVQYSPQVLYEPCTQ
DIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPSVQPRTQKFFEMIENHPLSTKLLVPS
LMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINM
LINDTTFLLDESLESLKRIHEVQEEMKNQEQWDQLPRDQQQARQSQLAQDERVSRSYLAL
ATETVDMFHLLTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVENPEKYGFEPK
KLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIAIEKFKLLAE
KVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDP
FNRQMLTESMLEPVPELKEQIQAWMREKQSSDH
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgagcgctgacgagattcgacggaggcgcctggcacgacttgctggtgga
cagacctcccagccgaccaccccgcttacatctccccagagggagaaccctccaggacct
ccaatagctgcatcagtcccaggcccctcccagagccttggtctcaatgtccacaacacg
accccagctacctcccccataggtgcagcaggagttgcccatcggagccagagcagtgaa
ggcgtcagttctcttagcagctcaccttccaacagccttgagacgcaatctcagtccctc
tcacgttcccagagcatggatatcgatggtgtctcctgtgagaagagcatgtcccaggtg
gatgtggattctggaatcgagaatatggaggtggacgagaacgaccgaagagaaaaacgg
agcctgagtgacaaggagccttcttcaggtcctgaagtgtctgaagagcaggccttacag
ctggtctgtaagatcttccgtgtctcctggaaggaccgcgacagagatgtcatcttcctt
tcttctctctctgcgcagtttaaacagaacccaaaagaagtgttctctgattttaaggat
ctgattggccagattttaatggaagtgctgatgatgtccactcagacacgagatgaaaat
ccgtttgccagtctgacggccacatcccagcccatcgccacggcagctcggtcaccagac
agaaacctcatgctgaacacaggctccagttcggggacaagtcccatgttctgcagcttg
ggttccttcagcgccagctcactctccagtttgggagcctctggtggagcaagtacctgg
gattcttacagtgaccatttcaccattgaaacctgcaaagagacggacatgctgaactac
ctcatcgagtgctttgaccgagttggaatagaggaaaaaaaagcaccaaagatgtgcagc
cagccagcagtcagccagcttctgagcaacatccgctcgcagtgcatctcccacaccgcg
ctagtgctacaagggtccctcacacagcccaggtccttgcaacagccatccttcctcgtg
ccgtacatgctctgcaggaatctcccgtacggcttcattcaagagctggtgaggaccact
caccaggatgaagaggtgttcaagcagatctttatccccattttacaaggcctggcgcgt
gctgccaaagagtgctccttggatagcgactactttaagtaccccctcatggcactgggt
gaactctgtgaaaccaagttcgggaagacacaccctatgtgcaatttggtcgcctcctta
cccctgtggttgccgaagtccttaagccctggttctgggcgggagctgcagagactctcc
tacttaggggccttctttagcttctctgtcttcgcagaggacgatgcaaaggtggttgag
aaatacttctcagggcctgccattaccctggagaacacccgtgtggtcagccagtcacta
cagcattacctggagctgggacggcaagagcttttcaagattctgcatagtattttgtta
aacggcgaaactcgtgaagcagcactcagttacatggcagccattgtcaatgccaatatg
aagaaagcgcagatgcaggcagatgatcggttggtgtctacagacgggttcatgctgaat
ctcctttgggtcctgcagcagctaagtacaaaaatcaagttagaaacggtcgaccccact
tacatattccacccgagatgtcggatcactctgccaaacgatgagacacggataaatgca
acgatggaggatgtgaacgagtggctgacagagctctatggagatcagcctccattttct
gagccaaaattccctacagaatgcttctttctcaccctgcacgctcaccatctctctatc
ctgcctagttgtcgtcgctacattcgccggctccgagccatccgtgagctcaatagaacc
gtggaagatttgaaaaataatgaaagccagtggaaagattccccactggccaccagacac
cgcgaaatgctgaagcgctgtaaaactcagcttaagaaactggtacggtgcaaggcctgt
gctgacgctggcttacttgacgagagcttcctaagaagatgtctgaatttttatggcctt
ctcattcagctgatgctgcgcgtcctggaccctgcatatcctgacataacactgccttta
aattcagaagtccccaaggtatttgcagcattgcctgagttttatgtagaagatgttgct
gaatttttattttttattgtacaatactctcctcaggtgctttatgagccctgcactcag
gacattgtgatgttcctcgttgtgatgctgtgcaaccagaactacatccgaaacccttac
ctagtggccaagctcgtggaggtcatgtttatgaccaacccctctgttcagccgagaact
cagaagttttttgagatgattgagaaccatcctctctctaccaaattgctggtaccgtcc
ctcatgaagttctatacagacgtcgagcatactggagccaccagcgagttctatgacaag
ttcacaattcgctatcacatcagcactatttttaaaagcctttggcaaaacatagctcac
catggcaccttcatggaggagttcaattctggaaagcagttcgttcggtatatcaacatg
ctgataaatgacacgacctttttactggacgaaagtctggagtctctgaagcggatccat
gaagtgcaagaggagatgaagaaccaagagcagtgggaccagctgccccgggatcagcag
caggcccggcagtctcagcttgctcaggacgagcgtgtttcccgttcctatctcgccctg
gcgactgaaaccgtggacatgttccatctcctcaccaagcaagtccagaagccgttcctg
aggccagaacttggtccccggttagcagccatgctgaactttaacctgcagcagctctgc
gggcccaagtgccgggacctcaaagtggaaaacccagagaagtacggttttgagccaaag
aagctgttggaccaactgacggatatctacttacagctggactgtgctcgctttgctaaa
gccatcgctgatgaccagcgatcctacagcaaggaactgttcgaagaagtcatttcaaag
atgcggaaggcaggaatcaaatccaccatcgcaatagaaaagtttaagcttcttgcagag
aaagtggaggaaatcgtggcaaagaatgctcgggcggaaatagactacagtgacgccccg
gacgagttcagagaccctctgatggacaccctgatgactgatcccgtgagactgccctct
gggaccatcatggaccgttctatcatcctgcggcatctgctcaactcccccaccgacccc
ttcaaccgccagatgctgactgagagcatgctggagccagtgccagagctaaaggagcag
attcaggcctggatgagagagaagcagagcagtgaccactaa

DBGET integrated database retrieval system