KEGG   Rattus norvegicus (rat): 298676Help
Entry
298676            CDS       T01003                                 

Gene name
Morn1
Definition
(RefSeq) MORN repeat containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MORN
Motif
Other DBs
NCBI-GeneID: 298676
NCBI-ProteinID: NP_001005544
RGD: 1359433
Ensembl: ENSRNOG00000014642
UniProt: Q641X6
Position
5q36
AA seq 483 aa AA seqDB search
MAAAEDQNPASLQPLRHSPRLRPRNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGS
YYEGEFVNGEITGEGYQHWAWSGNTYSGQFVLGEPQGHGIMKYKAGGHYEGELSQGLREG
QGFLEDQDGQVYQGSFHDNKRHGRGQMVFKNGDKYEGDWVRDQRQGHGVLFCADGSTYKG
QWHNDVFSGLGSLVHCSGVTYCGMFINGHPAAQAKKIVVLGPELLEVVQGSPFTLSVQLQ
QDDGEVAKSESGRVLKISAGVRYVQLPEYSEVSFFKMDDAHMETPIQTPFGFQCIPYPLS
VSTSWGLEPGSTVESARADLLLSKKDSEPVLDSEAFHGKGDTLSILPARRHEPCCSAAYQ
RVDQGCAEFVDIHLGAPPPGMQPYLFLPSMLEKAGNRPKGDRSPPEVLSTAQEPLRGTNR
SDGTTAEPSTAAYLGEYVLMVCDVTSPPFLGHRLPTTFKHLRILARGDIHLPHVPEDHPE
ALS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctgaggatcagaacccggcttcgctccaacctctccggcactcgccgaga
ctgcgaccgcgaaacggctatggcgtatatgtatacccaaattctttcttccgctatgaa
ggagaatggaagggaggcaagaaacatggtcatgggaagctattgtttaaagatggaagt
tattatgaaggcgaatttgtgaatggagaaatcactggggaaggctaccagcactgggcc
tggtcaggaaacacctactctggacagtttgttttaggagagcctcaaggacacggcatc
atgaagtacaaagccggaggtcactacgagggggagctctcccaaggcctgagggaaggg
caagggtttctggaggaccaggatggacaggtgtaccagggttccttccatgacaataag
agacatggccgtgggcagatggtctttaagaatggtgacaagtacgaaggtgactgggtt
cgagaccagcgtcagggacatggggtgctgttctgtgctgatggctccacatacaaggga
cagtggcataatgatgtcttcagcgggcttggcagcttggtccactgctcaggagtcacc
tactgtgggatgttcattaatggccacccagcagcacaagctaagaagattgtggttctg
ggtccagagttactggaagtggtccaaggatctcccttcacgttgagtgtacagctgcag
caagatgacggggaagttgccaaaagtgagagcggccgggtcctgaagatctcagcagga
gtcagatacgtgcaactcccggagtactctgaggtcagctttttcaagatggatgacgct
cacatggagacacccatccagaccccattcgggttccagtgcattccctaccctctgtct
gtgtcaacatcctggggtctggagcctgggtccactgtggaaagcgccagagctgacctg
ctactctccaagaaagactcagagccagtgctggactcggaagccttccatggcaaggga
gacaccctcagcatcctgccagccaggagacatgaaccctgctgttctgctgcctatcag
cgagtggaccaaggctgtgctgagtttgtggacattcaccttggagcccctccgcctggg
atgcagccctatctgttcctgcccagcatgcttgagaaggctggcaacaggcctaaaggt
gaccggagtcccccggaggtgttgtccactgcccaggaacctctaagaggcaccaacagg
tctgatgggaccacagcagagccatcgacagctgcatatctaggggagtatgtgctcatg
gtctgtgacgtcaccagccctccattcctgggccacaggctgcccaccaccttcaaacac
ctgcggatcctggcaaggggggacatccacttgccccatgtccctgaagatcacccagaa
gctctaagctag

DBGET integrated database retrieval system