KEGG   Rattus norvegicus (rat): 298693
Entry
298693            CDS       T01003                                 

Gene name
Isg15, G1p2
Definition
(RefSeq) ISG15 ubiquitin-like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    298693 (Isg15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    298693 (Isg15)
   05169 Epstein-Barr virus infection
    298693 (Isg15)
   05165 Human papillomavirus infection
    298693 (Isg15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    298693 (Isg15)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   298693 (Isg15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_5 TUG-UBL1
Other DBs
NCBI-GeneID: 298693
NCBI-ProteinID: NP_001100170
RGD: 1310312
Ensembl: ENSRNOG00000021802
UniProt: D4A3X3
Position
5q36
AA seq 161 aa
MTWNLKVKMLGGKEFLVSMTNSMMLSELKKQVAQKSGVPAFQQRLAHQSGEMLQDGVALI
RQGLSSGSTVMLMVENCSHPLSILVRNERGRSNVYEVQLTQTVEVLMRQVSQHEQVSQDQ
FWLSFNGRPMEDKEPLGEYGLTPHCTVIMNLRLRGGGDYYF
NT seq 486 nt   +upstreamnt  +downstreamnt
atgacctggaacctaaaggtgaagatgctggggggcaaggagttcctggtgtccatgaca
aactccatgatgctgtcagaactgaagaagcaggttgctcagaagagtggtgtgccagct
ttccagcagcgcctggcccaccaaagcggtgaaatgctacaggatggtgttgcccttatc
aggcagggccttagttctggcagcacagtcatgctgatggtagagaactgcagccatcct
ctgagcatcctggtgaggaatgaaaggggccgcagcaatgtctatgaggtccagctgaca
cagactgtggaagtgcttatgaggcaggtgtcccagcacgagcaagtctcccaagaccaa
ttctggctgagcttcaacggaaggcccatggaggacaaagagccactgggggagtatggc
ctaacaccccactgcacagtgatcatgaatttgcgcctgagggggggaggggactactat
ttctaa

DBGET integrated database retrieval system