KEGG   Rattus norvegicus (rat): 298694Help
Entry
298694            CDS       T01003                                 

Gene name
Plekhn1, RGD1311019
Definition
(RefSeq) pleckstrin homology domain containing N1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH
Motif
Other DBs
NCBI-GeneID: 298694
NCBI-ProteinID: NP_001127995
RGD: 1311019
Ensembl: ENSRNOG00000020295
UniProt: D3Z815
Position
5q36
AA seq 615 aa AA seqDB search
MGNSHCVPQTPRRLRASFSRKPSLKGNREDSARKLAGLFGTEARPDGDTAANKIFHYIPG
TDILGPENHPENLEQPFLSVFKKGWRRTPVRNLGKVVHYSKVQLRFQHSQDISDCYLELF
PSHLYFQAHGSEGLTFQGLLPLTELSICPIDGSREHAFQITGPLPAPLLVLCHSEAELSH
WLYHLEKQMALLGLRQCHSAPPQGSLGDKLPWTQLWRAHGCEPMNSAICASRVKLQHLPS
QEQWDRLLVLYPASLAIFSEEPEGLNFKGELPLSAIHINLEEKEKEIRSFLIEGRLINTI
RVVCASYEDYSQWLLCLRTVSHRDGAHLLPGPESFPGLQRPTQVLGRGRGSLSSNGRTSR
KLECPVFPTSQSLPEPSVPTTIGVPAHPVPNQTNSNCVSTGQTKVELRHSGSSQFPRGKA
QREVSGSTAPLPLHLDLTKMSVLNLDSGPEAQDCSPDIPHSPLYADPYTPPAIAHHKITD
IQGLDEFLCAVQTSPGPELSSPFPSVSVSVPVSDSNSGISSSPRPLGSHLLSKKGALQSR
ASQRHRGSIKSRAPQPSDFPQLGKGSYFLNLMPESSLTPLLDEEAPIWNKTSSPSHQKWS
HPRKPAVEGGFIQWI
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggggaacagccactgcgtccctcagacccccaggaggctacgggcctccttttccaga
aaaccctcgctcaagggaaacagagaagacagcgccaggaagctggctggcctgtttggc
accgaggctaggcctgatggggacaccgcagctaacaagatcttccactacatccctggg
acggacatcctgggcccagaaaatcatccagaaaacctggaacagccattcctgagtgta
ttcaaaaaagggtggcggaggacacctgtgaggaacctaggcaaggtggtgcactattcc
aaggttcagctgcggttccagcacagccaggacatcagtgactgctatctggaactgttc
ccctcccacctgtacttccaggcccatggttctgaaggacttacattccaggggctgcta
ccactgacggaattgagcatctgcccgattgatgggtccagagagcatgccttccagatt
acaggcccactgcctgccccactccttgttctctgccacagtgaggccgagctcagccat
tggctctaccacctggaaaagcaaatggctctcctgggtctgcggcaatgccactcagca
cccccacagggttctctaggagataaactcccctggacccagctatggcgagcgcacggg
tgtgaacccatgaacagcgcaatctgtgcctcaagggtcaagctgcagcatctgccctcc
caggagcagtgggaccggcttctggtactgtacccagcatccctggccatcttctctgag
gagccagaaggccttaactttaagggggagcttccactaagtgccatccatatcaactta
gaagagaaggaaaaagagatccgctcctttctcatcgaaggccgtctcatcaacaccatc
cgagtggtgtgtgccagttatgaggattacagtcaatggctgctgtgcctcaggacggtc
tctcacagggatggggcccacctgctgcctggcccagagagtttcccaggactacagaga
cccacacaggttttaggtagaggccgaggttcactctcttccaatggacgaaccagccgg
aaattagagtgtccagtgttccctaccagccaatccctccctgagccctcagtgccaacc
accataggtgtccctgcccatcctgtgcctaaccagaccaactctaactgtgtcagcact
ggccaaacgaaggtagagctgaggcacagtggcagtagccagttccccaggggcaaagct
caaagagaagtatctggctcaactgccccactgcccctgcacctggacctgacgaagatg
agtgtcctgaacctagatagtggcccagaggctcaggattgctctccagacattccacac
tccccgctctatgctgatccctacacaccaccagctatagctcaccacaagattacagac
atccaaggcctggatgagttcctctgtgcagtacagacatcacctggacctgaactatca
agcccgttcccctcagtctctgtgtctgtgcctgtctctgactccaactctggaatctcc
agctccccccggcctctgggctcacacttgctctccaagaaaggagccctgcagtccaga
gcttcccagagacaccggggttccatcaagagcagggccccacagccctcagacttccct
cagcttggaaaggggtcctacttcttaaacctgatgcctgagtcgtctctgactccccta
ctagatgaagaggctcctatctggaacaagacttcctctccctcccaccagaagtggtca
catcccaggaagcctgcggtggaagggggattcatccagtggatctga

DBGET integrated database retrieval system