KEGG   Rattus norvegicus (rat): 298696
Entry
298696            CDS       T01003                                 

Gene name
Pin1
Definition
(RefSeq) peptidylprolyl cis/trans isomerase, NIMA-interacting 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    298696 (Pin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    298696 (Pin1)
   03110 Chaperones and folding catalysts [BR:rno03110]
    298696 (Pin1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     298696 (Pin1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     298696 (Pin1)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    298696 (Pin1)
SSDB
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2
Other DBs
NCBI-GeneID: 298696
NCBI-ProteinID: NP_001100171
RGD: 1310299
Ensembl: ENSRNOG00000020474
UniProt: B0BNL2
Position
8q13
AA seq 165 aa
MADEEKLPSGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGGSKNGQGEPARVRCS
HLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKA
RGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccgtccgggtgggagaagcgtatgagtcgcagctcaggc
cgtgtctactacttcaatcacatcaccaacgccagccagtgggagcggcccagcggaggc
agcaccgttggaggcggcagcaagaatggccagggtgagcctgccagggtgcgctgctca
cacctgctggtgaagcacagccaatctcggaggccctcatcctggcggcaggaaaagatc
accaggagcaaagaggaggccttggagctgatcaatggctacatccagaagattaagtca
ggagaggaggactttgaatctctggcctcacagttcagtgactgcagctctgccaaagcc
aggggagacctgggtgccttcagcagaggtcagatgcagaaaccgttcgaagatgcatcg
tttgctctacggaccggggaaatgagtgggccggtgttcacggattcaggcatccatatc
atcctacgcacagaatga

DBGET integrated database retrieval system