KEGG   Rattus norvegicus (rat): 298744Help
Entry
298744            CDS       T01003                                 

Gene name
Crim1
Definition
(RefSeq) cysteine rich transmembrane BMP regulator 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: VWC Antistasin IGFBP Amnionless
Motif
Other DBs
NCBI-GeneID: 298744
NCBI-ProteinID: NP_001162574
RGD: 1308710
Ensembl: ENSRNOG00000004208
UniProt: D4AEK3
Position
6q11
AA seq 1037 aa AA seqDB search
MYLVAGGRGLAGCGHLSVSLLGLLLLLARSGTRALVCLPCDESKCEEPRSCPGSIVQGVC
GCCYMCARQRNESCGGAYGLHGACDRGLRCVIRPPLNGDSITEYEVGVCEDEDWDDDQLL
GFEPCNENLISGCNIINGRCECSTIRTCNNPFEFPRKDMCLSALKRIEEEKPDCTKARCE
VQFSPRCPEDSILIEGYAPPGECCPLPSRCVCDPAGCLRKVCQPGYLNILVSKASGKPGE
CCDLYECKPVFSVDCSTVECPPVQQAVCPLDSYETQVRLTADGCCTLPARCECLSGLCAF
PVCEVGSTPRIVSRGDGTPGKCCDVFECVNETKPACVFNSVEYYDGDMFRMDNCRFCRCQ
GGVSICFTAQCGELNCERYYVPEGECCPVCEDPIYPFNNPAGCYANGQIRAHGDRWREDD
CTFCQCINGEPHCVATACGQSCMHPVKVPGECCPVCEEPTYITIDPPACGELSNCTLKEK
DCVYGFKLDHNGCRTCQCKNREERCLALKRACTLDCPFGFLTDVHNCELCQCRPRPKKCR
PTICDKFCPLGFLRNKHGCDICRCKKCPELPCSKVCPLGFQEDSHGCLICKCREVPTSAG
PPVLSGTCLSMDGHHHKNEESWHDGCRECYCHNGKEMCALITCPVPACGNPTIRPGQCCP
SCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLC
QNPSRTQDSCCPQCTEDPLQPSTSHNESVPSYCRNDEGDIFLAAESWKPDVCTSCVCMDS
SISCYSESCPSVACERPVLRKGQCCPYCLEDTIPKKVVCHFSGKTYADEERWDIDSCTHC
YCLQGQTLCSTVSCPPLPCAEPIKVEGSCCPMCPEMYVPEPTNVPIEKKNHRGEIDLEVP
MWPTPSENDIIHLPRDMGHLQVDYRDNNRLHPSEDSSLDSIVPVVVPIIICLSIIIAFLL
INQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDGSQRMLRIAEPDARFSGFY
SMQKQNHLQADNFYQTV
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgtacttggtggcggggggcagggggctggccggctgcgggcacctctcggtctcgctg
ctggggctgctgctgctgctggcgcgctcaggcacccgggcgctggtctgcctgccctgt
gacgagtccaagtgcgaggagcctcggagctgcccgggaagcatcgtgcagggcgtctgc
ggctgctgctacatgtgcgcccgccagaggaacgagagctgcggtggagcctatgggctc
catggagcctgcgaccgggggctgcgctgtgtcatccgccccccgctcaatggcgactcc
atcaccgagtatgaagtgggcgtctgcgaagacgaggactgggacgacgaccagctgctc
ggttttgagccctgcaatgagaacctcatctcgggctgcaatatcatcaacgggagatgc
gaatgcagtaccatccgaacctgcaacaacccctttgagttcccaaggaaggacatgtgc
ctttcggccttaaagaggatcgaagaagagaagccagattgcaccaaggcccgctgtgaa
gtgcagttctctccacgttgccctgaagattccattctgattgagggctatgctcccccc
ggggagtgttgtcctttacccagccgctgcgtgtgtgaccctgcgggctgtctgcgcaaa
gtctgccagccgggatacctgaacattctagtgtccaaagcctcagggaagccgggagag
tgctgtgacctctatgagtgtaaaccagttttcagcgtggactgcagcaccgtggagtgc
ccccctgtccagcaggccgtgtgccccctggacagctacgaaacgcaagtgcggctcaca
gcggatggctgctgtaccctgccagcaagatgcgagtgtctctctggcttatgtgctttt
cccgtttgtgaggtgggatctactccccgaatagtctctcgtggagatgggacacctgga
aagtgctgtgatgtctttgaatgtgttaatgaaacaaagccagcctgcgtgttcaacagt
gtggagtattacgatggagacatgtttcgaatggacaactgtcggttctgtcggtgccaa
gggggcgtctccatctgcttcaccgcccagtgtggggaactgaactgcgaaagatactat
gtgcctgagggggagtgttgccccgtgtgtgaagatcccatctatcctttcaacaacccc
gccggctgctacgccaacggccagatccgcgcccacggggaccggtggcgggaagacgac
tgcaccttctgccagtgtatcaatggagaaccccactgcgtggccaccgcctgcgggcag
agctgcatgcaccccgtgaaagtgcctggggagtgttgccccgtgtgtgaagaaccaacc
tacatcacaattgatccacctgcgtgcggggagttgtcaaactgtactctgaaagagaag
gactgcgtttacggcttcaaactggatcacaatggctgtcgaacctgtcagtgcaaaaac
agggaggaacgatgcttagcccttaaaagggcctgcactttggactgtcccttcggcttc
ctcaccgatgtccacaactgtgagctctgtcagtgccgcccacggcccaagaaatgcaga
ccaacaatatgcgacaagttttgtcctcttggattcctgaggaacaagcacggctgtgac
atctgtcgctgtaagaagtgtccagagcttccatgcagcaaggtctgccccttgggcttc
caggaggacagtcacggctgtctcatctgcaagtgcagagaggtccctacttcagccggg
ccacctgtcctgtcaggcacatgtctgtccatggatggtcatcaccataaaaacgaggag
agctggcatgatggctgccgggaatgctactgtcacaatgggaaggaaatgtgtgccctc
atcacctgcccagtgcctgcctgcggcaaccccaccatccggcccggacagtgctgccca
tcctgcgcagatgacttcgtggtgcagaagcccgagctcagcacgccttccatttgccac
gcccctggaggagagtactttgtggaaggggaaacgtggaacattgactcctgtacgcag
tgcacctgtcacagtggccgagtgctgtgtgagacggaggtgtgcccaccactgctctgc
cagaacccctcacgcacccaggactcctgctgcccacagtgtacagaggaccctcttcag
ccttccacatcccataatgagagcgtgcctagctactgcaggaatgatgaaggggacatc
ttcctggcggccgagtcctggaagcctgacgtctgcaccagctgcgtgtgcatggatagc
tccattagctgctactccgagtcttgcccttcggtggcctgcgaacggcccgttttgagg
aaaggccagtgttgcccctactgtctagaagacacgattccaaagaaagtggtgtgtcac
ttcagtgggaagacctacgctgacgaggagcggtgggacatcgacagctgcacacattgc
tactgcctgcaaggccagaccctctgctcgactgtcagctgcccaccattaccctgtgcc
gagcccatcaaggtggaagggagttgctgcccgatgtgcccagaaatgtatgtgccagag
ccaaccaatgtgcccattgagaagaagaatcatcgcggcgagattgacctggaggttccc
atgtggcccaccccaagtgaaaatgacatcatccacctccctagagatatgggtcacctc
caggtagattacagagacaataacaggctgcatccaagtgaagactcatcattggactcc
attgtccccgttgtggttcccataatcatatgcctgtccatcataatagcattcctgctc
atcaaccagaagaaacagtggataccgctgctgtgctggtaccggacaccaaccaagcct
tcttccttgaataatcagctggtatcggtggactgcaagaaaggcactcgggtccaggtg
gacggttcccagagaatgctaagaatcgctgaaccagatgcacgattcagtggcttctac
agcatgcagaaacagaaccatctacaggcagacaatttctaccaaacggtgtga

DBGET integrated database retrieval system