KEGG   Rattus norvegicus (rat): 298748
Entry
298748            CDS       T01003                                 

Gene name
Ndufaf7, RGD1311578
Definition
(RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 7
  KO
K18164  NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    298748 (Ndufaf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    298748 (Ndufaf7)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    298748 (Ndufaf7)
SSDB
Motif
Pfam: Methyltransf_28
Other DBs
NCBI-GeneID: 298748
NCBI-ProteinID: NP_001008319
RGD: 1311578
Ensembl: ENSRNOG00000005279
UniProt: Q5XI79
Position
6q11
AA seq 436 aa
MNALVRRCVARTGIPSIWRRKCFSSGNEPAESNHVTPMLRHLMYKIKSTGPITVAEYMKE
VLTNPAKGYYVHHDMLGEKGDFITSPEISQIFGELLGVWFVSEWMASGKSTAFQLVELGP
GRGTLTADILRVFSQLGSVLKTCDISIHLVEVSQKLSEIQALTLTEETVPLERDAESLVY
MKGVTKSGIPISWYRDLKDVPTGYSFYLAHEFFDVLPVHKFQKTPHGWREVFVDIDPQSP
DKLRFVLAPCATPAEAFIQRDERREHVEVCPDAGVVIQELSQRIASTGGAALIADYGHDG
TKTDTLRGFYEHQLHDVLTAPGTADLTADVDFSYLRRMAQGRVASLGPVEQRTFLKNMGI
DVRLKVLLDKAGDPSLQQQLLRGYDMLMNPQKMGERFHFFALLPHQRLHVGSQGGKACQS
EAPSTSVPGFDELVWH
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaatgctttggtgagacgctgtgtggcccgcacgggcattcccagtatttggagaagg
aagtgcttcagctccgggaatgagccggcagaaagcaaccacgtgacaccgatgctgcgg
catcttatgtataaaataaagtctacaggtcccatcactgtggccgagtacatgaaggag
gttttgaccaatccagccaagggatattacgtgcaccatgatatgctaggagaaaaggga
gactttattacttcacctgaaataagtcaaatcttcggggagctactcggggtgtggttc
gttagtgaatggatggcctccggaaagagtacagccttccagctggtggaacttggtcca
ggtcggggtaccctcacagcagatattttgagggtgttcagtcagcttgggtctgtgcta
aaaacctgtgacatttcaatacaccttgtagaggtgagccaaaagttaagtgagatccaa
gcactgacactgaccgaggagacagtccctttggagagagatgctgaatccctagtgtac
atgaaaggtgtcacgaagtctgggattccaatctcctggtatcgagacctgaaggatgtt
cctacaggatacagcttttatctcgcacatgagttttttgatgttcttcctgtgcataaa
tttcagaaaacaccacatggatggagagaagtgtttgttgatatcgacccacaatctcct
gataaactgaggttcgtcttggcgccttgtgcgactccagcagaagccttcatacaacgc
gatgaaagaagggagcatgtggaggtttgtcctgatgctggggttgtcatccaggaactg
tcccagcgcattgcatcaactggaggtgctgccctgattgcggattacggtcacgatgga
acaaagactgacaccttgagagggttttatgaacaccagctgcacgatgtcctgacagct
cctggaacagcagacctgacagctgacgtagacttcagttacctgcgcagaatggcacaa
ggacgagtagcttctctgggtcccgtggaacaaagaacatttctaaaaaacatgggcatt
gatgtgcggctgaaggttcttttggataaagcaggtgacccatccctgcagcagcagcta
cttcggggatacgatatgctaatgaatcctcagaagatgggagagagatttcacttcttt
gccttgctgcctcatcagagacttcatgtgggaagtcaaggagggaaggcctgccagtca
gaagccccctcgacctctgtacctgggtttgatgaactggtttggcactga

DBGET integrated database retrieval system