KEGG   Rattus norvegicus (rat): 298771Help
Entry
298771            CDS       T01003                                 

Gene name
Prepl, RGD1310143
Definition
(RefSeq) prolyl endopeptidase-like
  KO
K22582  prolyl endopeptidase-like [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    298771 (Prepl)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     298771 (Prepl)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   298771 (Prepl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S9 Peptidase_S9_N Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 298771
NCBI-ProteinID: NP_001010951
RGD: 1310143
Ensembl: ENSRNOG00000007326
UniProt: Q5HZA6
Position
6q12
AA seq 638 aa AA seqDB search
MDAFEKVRTRLETQPQEEYEIVNAEIKHGGFVYYQEGCCLVRSKDEEADSDNYEVLFNLE
ELKLEQPFIDCIRVAPDEKYVAAKIRAEDSETSTCIVVKLSDQPAMEASFPNVSSFEWVK
DEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTLNI
MNKTTSEVWLIDGLSPWDPPMLIQKRIHGMLYYVEHRDDELYILTNVGEPTEFKLMRTAA
DAPAIMNWDLFFTMKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPW
ACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRIEAK
SKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKMNFRPERRVLVDDGWILAYCHV
RGGGELGLQWHADGRLTKKLNGLADLEACIKTLHSQGFSQPSLTTLSAFSAGGVLVGALC
NSKPELLRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPCQNM
KPQHYPSVHITAYENDERVPLKGIVNYTEKLKEAVAEHSKGAGEGYQPPNIVLDIQPGGN
HVIEDSHKKITTQMKFLYDELGLDSTDAFEALKKYLKV
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggatgcatttgaaaaagtgaggacaaggctagaaacacagccacaggaagagtacgaa
atcgtcaatgcggagattaaacatggcggctttgtctattatcaagaaggttgctgcttg
gtccgttccaaagacgaagaagctgacagtgataattatgaagttttattcaacctggaa
gaacttaaactggagcagcccttcatcgattgcatccgagttgctcctgatgagaagtac
gtggctgctaagataagggcggaggattctgaaacctccacctgcatagtggtgaagctc
agcgatcagcctgccatggaagcctctttccccaacgtgtccagctttgaatgggtgaag
gatgaagaagatgaagatgtcttattctacaccttccagaggaaccttcgctgtcacgat
gtgtaccgagccacgtttggtgacaacaaacgcaatgagcggttctacacagagaaagac
cccagctattttgttttcctctatcttacaaaagacagtcgtttcctcaccctgaatatc
atgaacaagacgacttccgaggtgtggctcatcgatggcctgagcccgtgggacccacca
atgctcattcagaagagaatccatgggatgctttactatgttgagcatcgagatgacgaa
ttgtacatcctgactaatgttggagaacctacagaattcaagctgatgcggactgcagct
gacgcccctgctattatgaattgggatttatttttcacaatgaagagaaacaccaaggtt
gtagacttggacatgtttaaggaccactgcgttctgttcctgaaacacagcaatctcctc
tatgttaatgtgattggtctggctgacgactccgtccgctctctaaagctgcctccttgg
gcctgtggattcataatggatacaaattctgacccgaagaactgccccttccagctttgc
tccccaataagacccccaaaatattacacatacaaatttgcagagggcaaactgtttgag
gaaactggtcacgaagatccaatcacaaagaccagtcgagttttacgcatagaagccaaa
agcaaggatggaaagctagtgcccatgacggtttttcacaagacggattctgaggacttg
cagaggaagcctctcttggtgcacgtatatggagcttacggaatggatctgaagatgaac
ttcaggcctgaaaggcgggtcttggtggatgatgggtggatcttagcatattgccatgtt
aggggtggtggcgagctgggtctccagtggcatgctgatggccgtctaactaaaaagctc
aatggcctggctgacttagaggcttgcattaagacgcttcacagccagggcttttctcag
cccagcctaacaacgctgagcgctttcagtgctggaggtgtgcttgtgggagcactgtgt
aactctaagccagagctcctgagagcagtgaccctggaggcccctttcttggatgttctc
aacaccatgatggacaccacacttccgctgacactggaagagttggaagaatgggggaac
ccttcgtccgatgagaaacacaagaactacataaagcgctactgtccatgccagaatatg
aagccacagcattacccttcagttcatatcacagcgtatgaaaacgacgagcgagtgccg
ctgaaaggaatcgtgaactacaccgagaagcttaaggaggccgtcgcagagcacagcaag
ggagcaggggaaggctatcagccccccaacattgttttagatattcagcctggagggaac
catgtgattgaggattctcacaaaaagatcacaacccagatgaaattcctgtatgatgaa
cttggacttgacagcactgatgctttcgaggctctgaagaagtacctaaaagtctga

DBGET integrated database retrieval system