KEGG   Rattus norvegicus (rat): 298784
Entry
298784            CDS       T01003                                 

Gene name
Nlrc4, Card12, Ipaf
Definition
(RefSeq) NLR family, CARD domain containing 4
  KO
K12805  NLR family CARD domain-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05132  Salmonella infection
rno05134  Legionellosis
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    298784 (Nlrc4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    298784 (Nlrc4)
   05135 Yersinia infection
    298784 (Nlrc4)
   05134 Legionellosis
    298784 (Nlrc4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    298784 (Nlrc4)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   298784 (Nlrc4)
SSDB
Motif
Pfam: NLRC4_HD NACHT CARD AAA_29 AAA_16 GGA_N-GAT
Other DBs
NCBI-GeneID: 298784
NCBI-ProteinID: NP_001296361
RGD: 1309831
Ensembl: ENSRNOG00000005810
UniProt: F1M649
Position
6q13
AA seq 1023 aa
MNFIKENSQALIQRMGIVVIKQICDDLFALNVLNGEEVAIICSHRVEQDAARDIVHMILK
KGSAACNLFLKSLENWNYPVYQDLTGHSLFHQNLEEDLDVLAQSLKDLYNSPVFKNFFPL
GEDIDIIFNLQITFTEPVLWRKDHRHHRVEQMTLGSLLEALKSPCLIEGESGKGKSTLLQ
KIAMLWASGMCPALNQFKLVFFIRLSSARGGLFETLYDQLVNIPDSISKPTFRALLLKLH
KKVLFLLDAYNEFHPQNCPEIEALVKENHRFKNMVIVTTTTECLRHIRHVGALTVEVGDM
TEDSARVLIREVLINELAEGLLFQMQESRCLRNLMRTPLFVVITCAIQMGSEEFQAHTQT
MLFQTFYDLLIQKNRRRHSGGTSGDFVRSLDYCGDLALEGVFSHKFDFELEDVCSMNEDV
LVRTGLLCKYTAQRLRPTYKFFHKSFQEYTAGRRLSSLLKSREPEEVSKGNSYLKKMVSI
SDITSLYGNLLLYTCGSSTEATRAIMRHLAMVCEHGSLQGLSVTKRPLWRQESIQNLRNT
TEQDVLKAINVNSFVECGINLFSESISKSELSQEFEAFFQGKSLYINSENIPDYLFDFFK
YLPNCVSALDFVKLDFYGRATVSQDKTGENSSGVHTEGPSTYIPSRAVSLFFNWMQKFKT
LEVTLRDISKLNKQDIKYLGKIFSSASNLKLYIKRCAAVAGRLSSVLRTCKNIHSLMVEA
SPLTTEDEQYITSVTDLQNLSIHDLHTQRLPGGLADSLGNLKNLLKLILDDIRLNEEDAK
SLAEGLRNLKKMRLLHLTRLSDMGEGMDYIVKSLSEEPCDLQEMKLVDCCLTANSLKILA
QNLHNLVKLSVLDMSENYLEKAGSEALQGLIGRLGVLEQLSALMLPWCWDAYISLPNLLK
QLEGTPGLVKLGLKNWRLRDEEIRSFGEFLEMNPLRDLQQLDLAGHGVSSDGWLSFMDVF
ENLKQLVFFDFGTEEFLPDAALVRKLGQVLSKLTLLQEARLTGWELDDYDISVIKGTFKL
VTA
NT seq 3072 nt   +upstreamnt  +downstreamnt
atgaactttataaaggaaaacagccaagcccttattcagaggatgggcatagtggttata
aagcaaatctgtgatgacctatttgcattgaacgttctcaacggggaagaagttgccatc
atttgcagtcatcgggtggagcaggacgctgcacgagacatcgtccatatgattttgaag
aagggctcagcggcctgcaacctctttcttaagagtcttgaaaactggaactatcctgtg
tatcaggacttaactggacacagtctttttcatcagaacttggaagaagacttggatgtt
ctggcccagagtctaaaagacttatacaacagccctgtttttaagaacttctttcctctg
ggtgaggatatcgacatcattttcaatctgcagatcaccttcacagaacctgtcttgtgg
aggaaggaccatcgtcatcaccgagtagagcagatgaccctgggcagcctgctggaggct
ctgaagagtccctgcctcattgaaggggagtctggcaaagggaagtccaccctgctgcaa
aaaattgccatgctctgggcctctgggatgtgcccagctctgaaccagttcaaattggtc
ttcttcatccgcctgagcagtgctaggggtggcctgtttgaaacattgtatgatcagctc
gtgaacatacctgactccatcagcaaaccaaccttcagggctctgctgctgaagttacac
aagaaagtcctctttctcctcgatgcttacaatgaattccatccccagaactgcccagaa
atcgaggccctggtaaaggaaaaccatcgtttcaagaacatggtcattgtcaccaccacc
acggagtgcctgaggcacatcagacacgttggcgccctgactgtggaggtgggagatatg
accgaagacagcgcccgagttctcatccgggaagtgctgataaatgaactggctgaaggc
ttgttgttccagatgcaggagtccaggtgcttgagaaatctgatgaggacccctctcttc
gtggtgataacctgtgccatccagatgggcagtgaggaattccaagctcacactcaaacc
atgctcttccaaaccttctacgacctcctgatacagaaaaacaggcgcagacacagtgga
ggaacttcaggtgattttgtcaggagcctagactactgtggagacctggccctggaaggt
gtgttctcccacaagtttgatttcgaacttgaggatgtgtgcagcatgaatgaggacgtc
ctggtgaggacggggctcctctgtaagtacacggctcagaggctgaggcccacgtataaa
ttctttcataaatcctttcaggagtacacagcaggtcggagactcagcagtttgttgaag
tccagagagccagaggaggtgagcaaggggaatagctacttgaagaaaatggtttccatc
tccgacatcacatccctgtatggtaatctgctcctgtacacttgtgggtcatccacagaa
gcaaccagggccatcatgaggcaccttgcaatggtatgtgagcatggcagcctacaagga
ctttctgtcaccaagcggcctctttggagacaggagtcaatacaaaacctgagaaacacc
actgagcaagatgttctgaaagccatcaacgtaaattcctttgtagagtgtggtatcaat
ttattctcggagagtatatctaaatcagagctgagccaagaatttgaagctttcttccaa
gggaaaagtttatacatcaactccgagaacatccctgattacttattcgacttctttaaa
tacttgcctaattgtgtaagcgcactggacttcgtcaagctggatttctatggaagagcg
acagtgtcccaggacaagacgggagagaacagctctggagtccacacggaagggccctcg
acctacattcccagtagggctgtgtctttgttcttcaattggatgcagaaattcaagact
ctagaggtcacactccgagatattagcaagttgaataaacaagatatcaaatacctgggg
aagatattcagctccgccagcaacctcaagttgtacatcaagaggtgcgcagccgtggcc
ggaaggctcagctcagtcctcagaacctgcaagaacatccactccctcatggtggaagct
agtcccctcaccacggaggatgagcagtacatcacgtctgtgacagacctccagaactta
agcattcacgacctccacactcaacggctgccaggtggtctggctgacagcttgggtaat
ctgaagaacctcctgaagctcatcctggatgacattaggctgaacgaggaagatgctaaa
agcctagcggaaggcctgcgaaacctgaagaagatgcgtttacttcatttgactcgtttg
tctgacatgggggaggggatggactacatagtcaagtctctctcggaagaaccctgtgat
ctacaagagatgaagttggtggactgctgtctgaccgcaaattctctgaaaattctagca
cagaatcttcacaatttggtcaagctgagcgttcttgatatgtcagaaaattatctggaa
aaggccggaagtgaagctctacagggactgatcggcaggcttggcgtgctagaacagcta
agcgcgttgatgctgccttggtgctgggatgcgtacatcagtctgcccaatctgctgaag
caactggaggggaccccagggcttgtcaaacttggattgaaaaactggaggctcagagac
gaagagattagaagtttcggtgaatttttggagatgaatcctctgagagacttgcagcag
ttggatttagcaggacacggtgtgagcagtgatggatggctttctttcatggatgtgttt
gagaatcttaagcagttggtattttttgacttcggcactgaagagttcttaccagacgca
gcgctggtgaggaaactcggtcaagtgttatctaagctaactctgctgcaagaggcaagg
ctcacaggctgggagcttgatgactatgacataagtgttattaaaggaacctttaaacta
gtgactgcttga

DBGET integrated database retrieval system