KEGG   Rattus norvegicus (rat): 298786
Entry
298786            CDS       T01003                                 

Gene name
Slc30a6
Definition
(RefSeq) solute carrier family 30 member 6
  KO
K14693  solute carrier family 30 (zinc transporter), member 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    298786 (Slc30a6)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC30: Zinc efflux transporter
   298786 (Slc30a6)
SSDB
Motif
Pfam: Cation_efflux
Other DBs
NCBI-GeneID: 298786
NCBI-ProteinID: NP_001264208
RGD: 1309250
Ensembl: ENSRNOG00000005856
UniProt: B2RZA8
Position
6q13
AA seq 460 aa
MGTIHLFRKPQRSFFGKLLQEFRLVAADRRSWKILLFGAINVLCTGFLLMWCSSTNSIAL
TAYTYLTIFDLFSLITCLISYWVMMRRPSAAYSFGFERLEVLAVFASTVLAQLGALFILK
ESAERFLEQPEIHTGRLLVGTFVALSFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLS
RSLCGIIPGLSSIFLPRMNPFVLIDLAGALALCITYMLIEINNYFAVDTASAIAIALMTF
GTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVH
VRIRRDANEQMVLAHVTNRLCTLVSTLTVQIFKDDWIRPALSSGPVAPNVLNFSDHHIIP
MPLLKNNDERTPVTSTPAKPSSPPPEFAFNTPGKNVSPVILLNTQTRPYGLGLNRGHTPY
SSMFSQGLAFPGVGAGQGLRPTFPHIPSRYGINRMGQPRP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggggacgattcatctctttcgaaagccacagagatccttttttggaaagttactacag
gaatttagactcgtagcagctgaccgaaggtcctggaagatacttctttttggtgccatc
aacgtgctgtgcactggcttcctgctcatgtggtgcagctctactaacagcatcgcttta
actgcttatacttacctcaccatttttgatctctttagtttaattacatgtttaataagc
tactgggtgatgatgaggagacctagcgctgcctattcgtttgggtttgaaagactagaa
gtcctggctgtatttgcttctactgtcttggcacaattgggagccctctttatactaaaa
gaaagtgcagaacgctttttggagcagcctgagatacacacgggaagattattagttggt
acttttgtggccctttctttcaacctgttcacgatgctttctattcggaataagcctttt
gcttacgtctctgaagctgcaagtacgagctggcttcaagagcatgtggcagaccttagt
cgcagcttgtgcggcattatcccaggactcagcagtatcttcttgccccgcatgaacccg
tttgttctgatcgatcttgctggggcgcttgctctgtgtataacatacatgctgattgaa
attaataattactttgctgtagacactgcgtcagcgatcgccattgccctgatgacattt
ggcaccatgtatcccatgagtgtgtacagtgggaaggtgcttctccagacaacaccacct
catgttattggtcagttggataaactgattagagaggtgtctaccttggatggggtgtta
gaagtccgaaacgaacacttttggacccttggatttggctccttggctggatcagtgcat
gtaagaattcgacgagatgcaaacgaacaaatggtccttgctcatgtgaccaacaggctg
tgcacgctggtgtccactctgactgttcagatcttcaaggatgactggattaggcctgcc
ctgtcatctgggcctgttgcacccaatgtgctaaacttctcagaccaccacataatccca
atgcctcttttaaagaacaatgatgagaggacccctgtcacatccaccccagccaagccc
agcagcccacctccggagtttgcatttaatacgcctgggaaaaatgtgagcccagtcatt
cttctgaacacacagacaaggccatatggtttgggtcttaatcgtggacacacaccatac
agcagtatgttcagccaaggacttgcgtttccaggagttggagcaggtcagggattgagg
cccaccttcccacatataccaagcaggtacggaatcaacaggatgggacagccaagaccc
tga

DBGET integrated database retrieval system