KEGG   Rattus norvegicus (rat): 298836
Entry
298836            CDS       T01003                                 

Gene name
Snx17
Definition
(RefSeq) sorting nexin 17
  KO
K17929  sorting nexin-17
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    298836 (Snx17)
SSDB
Motif
Pfam: SNX17_FERM_C PX RA Ras_bdg_2 FERM_M Nod1 DUF2777
Other DBs
NCBI-GeneID: 298836
NCBI-ProteinID: NP_001011981
RGD: 1306424
UniProt: Q6AYS6
Position
6q14
AA seq 470 aa
MHFSIPETESRSGDSGGSTYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSDGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIEHGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGGTSTPSRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGNLRRSDSQQAVKSPPLLE
SPDASRESMVKLSSKLSAVSLRGIGSPSTDASASAVHGNFAFEGIGDEDL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcacttttccattcctgaaaccgagtcccgcagcggggacagcggcggctccacctac
gtggcctataacattcacgtgaatggagtcctgcactgtcgtgtgcgctacagccagctc
ctggggctgcacgagcagcttcggaaggagtatggggccaatgtgcttcctgcattcccc
ccaaagaagcttttctctttgacgcctgcagaggtagaacagaggagggaacagttagag
aagtacatgcaagctgttcggcaagatccattgcttgggagcagtgagacctttaatagc
tttctacgtcgggcccaacaggagacacaacaggtccccacagaggaggtttccttggaa
gtgttgctcagtgacggacagaaagttctggtcaatgtgctaacttctgaccagacggaa
gacgtcctggaggccgtggctgcaaagctggatcttccagatgacttgatcggatatttt
agtctcttccttgttcgagaaaaagaagatggcgccttttcttttgtacggaagcttcag
gagtttgagctgccttacgtatctgtcaccagtcttcggagtcaagagtataagatcgtg
ctcagaaagagttactgggactctgcctatgacgacgatgtcatggagaaccgggttggc
ctgaacctgctttatgcccagacggtgtcagacatcgagcatggctggatcctggtcacc
aaggagcagcaccgacagctcaaatctctgcaagagaaggtctccaaaaaggagttcttg
cggctggcccagactctgcggcactatggctatctgcgctttgatgcctgtgtggctgac
tttccggagaaggactgccctgttgtggtcagtgcaggcaacagtgagctcagtctccag
ctgcgactcccaggccagcagctccgtgaaggctctttccgggtcacccgaatgcggtgc
tggcgggtcacctcctctgtgccactccccagtgggggtacaagcactccaagccggggt
cggggtgaggtacgcctggaactggcttttgaatacctcatgagcaaggaccggctacag
tgggtcaccatcaccagcccacaggctatcatgatgagcatctgcctgcagtccatggta
gatgagctgatggtgaagaagtctgggggcagtatcaggaagatgctgcgtcggagggtg
gggggcaacctgagacgttcagacagccagcaagcagtgaagtccccaccattgctcgaa
tcaccagatgccagccgggaatccatggtcaaactctcaagtaaactgagtgcggtgagc
ttgcggggaattggcagtcccagcacagatgccagtgccagtgccgtccacggcaatttc
gccttcgagggcattggagatgaggatctgtaa

DBGET integrated database retrieval system