KEGG   Rattus norvegicus (rat): 298850Help
Entry
298850            CDS       T01003                                 

Gene name
Cenpa, RGD1563607
Definition
(RefSeq) centromere protein A
  KO
K11495  histone H3-like centromeric protein A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    298850 (Cenpa)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     298850 (Cenpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 298850
NCBI-ProteinID: NP_001100181
RGD: 1563607
Ensembl: ENSRNOG00000032178
UniProt: B2RZ23
Position
6q14
AA seq 159 aa AA seqDB search
MVGRRKPGTPRRRPSSPAPGPSQPATDSRRQSRTPTRRPSSPAPGPSRRSSGVGPQALHR
RRRFLWLKEIKNLQKSTDLLFRKKPFGLVVREICGKFSRGVDLYWQAQALLALQEAAEAF
LVHLFEDAYLLSLHAGRVTLFPKDVQLARRIRGIEGGLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggcgccgcaagccagggaccccgaggaggcgaccctctagtccggcgcccgga
ccctctcagccagccacggactcgcgtcgccagtcgaggactccgacgaggcggccctcc
agtccggcgcccggaccctcgcgacggagctccggagtaggccctcaggcactacacaga
agacggagattcctgtggcttaaggaaataaagaacctgcaaaagagcacagacctcttg
tttaggaagaagcctttcggcctcgtggtaagagaaatatgtgggaaattcagccgtggt
gtggatttatattggcaagctcaggccttgttggcccttcaagaggcagcagaagcgttt
ctcgttcacctctttgaggacgcctatctcctctccttacatgctggccgagtcacgctt
ttccccaaagatgtgcagctagccaggaggatccgaggcattgagggaggactcggctga

DBGET integrated database retrieval system