KEGG   Rattus norvegicus (rat): 298874Help
Entry
298874            CDS       T01003                                 

Gene name
Pum2
Definition
(RefSeq) pumilio RNA-binding family member 2
  KO
K17943  pumilio RNA-binding family
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    298874 (Pum2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PUF PC4
Motif
Other DBs
NCBI-GeneID: 298874
NCBI-ProteinID: NP_001100185
RGD: 1311024
Ensembl: ENSRNOG00000006180
UniProt: D3ZQL8
Position
6q14
AA seq 1061 aa AA seqDB search
MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGTSHHSMSQP
IMVQRRSGQSFHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGTFGTRD
AETDGPEKGDQKGKASPFEEDQNRDLKQDDEDSKINGRGLPNGMDADCKDFNRTPGSRQA
SPTEVVERLGPSTNPPEGLGPLPNPTANKPLVEEFSNPETQNLDAMDQVGLDSLQFDYPG
NQVPMDSSGATVGLFDYNSQQQLFQRTNALTVQQLTAAQQQQYALAAAQQPHIAGVFSAG
LAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPWGVYPANLFQQQ
AAAAASNTANQQAASQAQPGQQQVLRPGAGQRPITPSQGQQGQQAESLAAAAAANPTLAF
GQSLAAGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTPVLISSAAAQAAAA
AAAAGGTANSLTGSTNGLFRPIGTQPPQQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLF
SHGPGQPGSASLGFGSGSSLGAAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSS
SSLAPIGQPFYNSLGFSSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSSSRGLTNGSGRYI
SAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRSDIMPSGRSRLLEDFRNNRFPNLQ
LRDLMGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEIVQAAYQLMTDVFGNYVIQKF
FEFGSLDQKLALANRIRGHVLPLALQMYGCRVIQKALESISSDQQSEMVKELDGHVLKCV
KDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAEQTLPI
LEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKC
VTHASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKIIMHKIR
PHITTLRKYTYGKHILAKLEKYYLKNSPDLGPIGGPPNGML
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgattttcaagctcttgcattagaatctcggggaatgggagagcttttgcct
accaaaaaattttgggaacctgatgattcaacaaaagatggacaaaaaggcatatttctt
ggggatgatgaatggagagagactgcatggggaacttctcatcattcaatgtcccagcct
attatggtacagagaagatctggacagagttttcatggaaacagtgaagtaaatgcaatt
ctttctccgcgctcagaaagtggaggccttggcgtgagcatggtagaatatgtattaagt
tcctctcctgctgataaattggattctcgatttaggaagggaacttttggtactagagat
gctgaaacagatggacctgagaaaggagatcaaaaaggcaaggcttctccatttgaggag
gaccaaaacagagatcttaaacaagatgatgaggactctaaaataaatggcagaggtttg
ccaaatggaatggatgccgattgcaaagattttaatcgtactccgggaagtcgtcaagcc
tctccaactgaagtagttgagcgccttggccctagtactaatcccccagaaggattgggt
cctcttcctaatccgacagcgaataaaccacttgttgaagaattttcaaatcctgaaact
cagaatctggatgcaatggaccaagttggtctggattccttacagtttgactatcctggt
aatcaggtacccatggattcttcaggagctactgtaggcctttttgactacaattcccaa
cagcagctctttcagaggactaatgcactaacagttcagcagttaactgctgctcaacag
cagcagtatgcattagcagcagctcagcagccgcatatagctggtgtattctcagcaggc
cttgctccagctgcatttgtgccaaatccatatattattagtgctgctcctccagggacc
gacccgtatactgcagcaggattggctgcagcagcaacattagcaggtccagcagtggtt
ccacctcagtattatggtgttccatggggggtgtatccagccaatttatttcagcaacaa
gctgcagctgcggcaagcaacacagccaatcagcaagcagcatcacaagctcagcctgga
cagcagcaggttcttcgtcctggagcaggtcaacgtcctattactcccagtcagggccaa
caagggcagcaagcagagtcacttgcagcagccgcagctgcaaacccaactttggctttt
ggtcagagtcttgctgcaggcatgccaggctatcaagtactagctccaactgcctattat
gatcagactggtgccttagtggttggccctggagcaagaactggccttggagctccagta
cgattaatggctccaacacctgtcttaattagttcagcagcagcacaagctgcagcagca
gcagcagcagctggaggaactgcaaatagtcttacaggcagcacaaacggtctgtttcgg
ccgattggcactcagccaccgcagcagcagcagcagcagcagccaagcactaacctgcag
tctaattcgttttatgggagcagctctttgactaacagctcccagagcagctctttattt
tctcacggacctggccaacctggaagtgcatctcttggctttggaagtggtagctctttg
ggagccgctataggctcagctctcagtggatttggctcatcagttggcagttctgcaagt
agtagtgccacaaggagagagtctctatctactagctctgacttgtacaaaagatctagt
agcagcctagcacccatagggcaaccattttacaatagtctgggattttcctcctctcca
agtccaataggcatgcctctgccaagccaaactccaggacattcacttacgccaccgcca
tcactttcatcacatggatcctcatccagaggcctgacaaatggtagtggtcggtacatc
tctgcagcacctggagcggaagcaaagtaccggagcgcttccagcacttccagcctgttc
agctccagcagccagctctttcctccctctcggctccgctataacagatctgatatcatg
ccctctggccgcagcaggctattggaagatttcaggaacaaccgcttccccaacctccag
cttagagacttgatgggacatatagtcgagttttctcaagaccagcatggctctagattc
atacagcagaagctagagagagctactccagctgagcgacagatggtatttaatgaaatt
gtacaggctgcctatcaattaatgacagatgtttttggaaactatgttatacagaagttt
tttgagtttggaagtttggatcagaaattagccctggctaatcgtattcgtggtcatgtt
ctaccattagccttgcagatgtatggctgccgtgttattcaaaaagcattagaatctatt
tcttctgatcagcagagtgaaatggtcaaggaacttgatggtcatgtacttaaatgtgtg
aaagatcagaatggaaaccatgttgtacagaagtgtattgaatgtgttcaaccgcagtca
ctgcagttcatcatcgatgctttcaaaggacaagtatttgtgctttcaacccatccttac
ggctgcagagtcattcagcggatcttagagcactgtactgcagagcagactttacccatc
ttagaagagcttcaccaacacacagagcagttggtacaggatcagtatggcaattatgtt
attcagcatgtactggaacatggtcggcctgaagacaagagcaaaattgtttctgaaatc
agaggaaaggtcttagccctgagtcaacacaaatttgccagcaatgtagtagaaaagtgt
gttactcatgcctcacgtgctgagagagctttactgattgatgaggtctgctgtcagaat
gatggtcctcacagtgccttatacaccatgatgaaggatcaatatgccaactatgtggtt
cagaagatgattgatatggctgagcctgctcagagaaagataatcatgcacaagattcga
cctcacatcactactcttcgcaaatacacatatgggaagcatatactggccaagttggaa
aaatactatttgaaaaacagcccagatctagggcctattggaggaccaccaaatggaatg
ctgtaa

DBGET integrated database retrieval system