KEGG   Rattus norvegicus (rat): 298875
Entry
298875            CDS       T01003                                 

Gene name
Laptm4a
Definition
(RefSeq) lysosomal-associated transmembrane protein 4A
  KO
K12387  lysosomal-associated transmembrane protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    298875 (Laptm4a)
SSDB
Motif
Pfam: Mtp
Other DBs
NCBI-GeneID: 298875
NCBI-ProteinID: NP_955416
RGD: 735179
Ensembl: ENSRNOG00000006865
UniProt: Q6P501
Position
6
AA seq 233 aa
MVSMTFKRSRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAV
NIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDF
VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFVVFIIFKAYLI
NCVWNCYKYINNRNVPEIAVYPAFEAPPQYVLPTYEMAVKIPEKEPPPPYLPA
NT seq 702 nt   +upstreamnt  +downstreamnt
atggtgtccatgactttcaaacggagccgcagcgaccggttctacagcacccggtgctgc
ggctgttgccatgtccgcaccgggacgatcatcctggggacctggtacatggtggtcaac
ctattgatggcaattttgctgactgtggaggtgactcatccaaattccatgccagctgtc
aacattcagtatgaagtcattggtaattactattcatctgagagaatggctgataatgcc
tgcgttctttttgccgtctctgttcttatgtttataatcagttcaatgctggtttatgga
gccatttcttatcaagtgggctggctgattcctttcttctgctaccgactttttgacttc
gttctcagttgtctggtagccatcagttctctcacttacttgccaagaatcaaagaatat
ctggatcagttgcctgatttcccctacaaagatgacctcctggcattggactccagctgc
cttctgttcattgtacttgtgttctttgtggtattcatcatttttaaggcttacctaatc
aattgtgtttggaactgctacaaatacatcaacaatagaaatgtgccagagattgccgtg
tatcctgcctttgaagcacctccacagtacgttttgccaacctatgaaatggctgtgaag
attcctgagaaagagccaccacctccttacctgcctgcctga

KEGG   Rattus norvegicus (rat): 315047
Entry
315047            CDS       T01003                                 

Gene name
Laptm4b
Definition
(RefSeq) lysosomal-associated transmembrane protein 4B
  KO
K12387  lysosomal-associated transmembrane protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    315047 (Laptm4b)
SSDB
Motif
Pfam: Mtp Flp1_like
Other DBs
NCBI-GeneID: 315047
NCBI-ProteinID: NP_001013192
RGD: 1311853
Ensembl: ENSRNOG00000006766
UniProt: Q5U1W4
Position
7
AA seq 227 aa
MKMVAPWTRFYSHSCCLCCHVRTGTILLGIWYLIINAVVLLILLSALADPDQYHFSGSEL
GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI
TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLVILLFIGIILTFKGYLISCVWSCY
RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVTGTAKEPPPPYVSA
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaagatggtcgcgccctggactcggttctattcccacagctgctgcctgtgctgccat
gtccgcaccggcaccatcctgttgggcatctggtacctgatcatcaatgccgtggtcctg
ttgatcctgctgagtgccctggccgatcccgatcagtatcacttttcaggctctgaacta
ggaggggaatttgagttcatggacgatgccaacatgtgcattgctatcgcgatctctctc
ctcatgatcctgatctgtgccatggctacctacggtgcatacaagcaacacgctgcctgg
atcatcccgttcttctgttaccagatctttgatttcgccctgaatactttggttgcaatc
accgtgcttgtctaccccaactccattcaggagtacataagacagctgccccccagcttt
ccctacagagatgacataatgtcagtgaaccctacctgtttggtccttgtcatccttctc
ttcataggcattattttgacatttaagggctacttgatcagctgtgtttggagctgctac
aggtacatcaatggcaggaactcctctgatgttctggtttacgttaccagcaacgatacc
acggtgctgttgccaccatacgatgatgccactgctgtgaccggcactgccaaggagcca
ccgccaccttacgtgtctgcctga

KEGG   Rattus norvegicus (rat): 89783
Entry
89783             CDS       T01003                                 

Gene name
Laptm5
Definition
(RefSeq) lysosomal-associated transmembrane protein 5
  KO
K12387  lysosomal-associated transmembrane protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    89783 (Laptm5)
SSDB
Motif
Pfam: Mtp DUF4728
Other DBs
NCBI-GeneID: 89783
NCBI-ProteinID: NP_445990
RGD: 621838
Ensembl: ENSRNOG00000011054
UniProt: Q6P9Z7
Position
5
AA seq 261 aa
MASRAVPVRQTCCCFNVRVATVALAIYHIVMSVLLFIEHVVEVARGKVSCRFSKMPYLRL
ADLLSSFLLIGVLFIISLSLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY
LKFARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGMPR
SQFINMMLIFSVAFITVLILKVYMFKCVWTCYRFMKHMNSAVEDSSSKLFLKVALPSYEE
ALSLPTKTPEGDLAPPPYSEV
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcctcccgtgcagtgccagtcaggcagacatgctgttgtttcaatgtccgagttgcc
accgtagccctggccatctaccatatagtcatgagcgtcttgctgttcattgagcatgtg
gtggaggtggcccgcggtaaagtctcctgcaggttctccaagatgccatacctcaggctg
gctgacctgctctccagcttcctgctcatcggagtcctcttcattatcagcctcagcctg
ctgttcggagtggtcaagaaccgggagaagtacctgatacccttcctgtcccttcaaatc
atggacttcctgctgtgcctgctcacactgttgggctcctacatcgaattaccagcatac
ctgaagtttgcccggccccggcccggtccttctaaggtacccttgatgacactgcagctg
ctggacttctgtttgagcatcctgaccctgtgcagctcctatatggaagtgcccacctac
cttaacttcaagtccatgaaccacatgaattacctgccgagtcaggagggcatgccacgc
agccagttcatcaacatgatgctcatcttttcagtggcctttatcaccgtgctcatcctg
aaggtctacatgttcaagtgtgtttggacatgctacagattcatgaagcacatgaattcg
gccgtggaggacagcagttccaagctgttcctaaaggtggctctgccgtcctatgaggaa
gccttgtctctgcccactaagactccagagggggaccttgcaccacccccatactcggaa
gtgtga

DBGET integrated database retrieval system