KEGG   Rattus norvegicus (rat): 298884Help
Entry
298884            CDS       T01003                                 

Gene name
Gen1, RGD1559792
Definition
(RefSeq) GEN1 Holliday junction 5' flap endonuclease
  KO
K15338  flap endonuclease GEN [EC:3.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    298884 (Gen1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     298884 (Gen1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     298884 (Gen1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_I Chromo_2 XPG_N RecR PNRC
Motif
Other DBs
NCBI-GeneID: 298884
NCBI-ProteinID: NP_001100187
RGD: 1559792
Ensembl: ENSRNOG00000004667
UniProt: D3ZVS5
Position
6q15
AA seq 908 aa AA seqDB search
MGVNDLWQILEPVKQHIHLQDLCGKTIAVDLSLWVCEAQTVKKMIGTVMKPHLRNLFFRI
SYLTQMNVKLVFVMEGEPPKLKADVMNKRTQTRYGPSGKSRSQKTGRSHFKSVLRECLEM
LECLGMPWVQAAGEAEAMCAYLNASGHVDGCLTNDGDAFLYGAQTVYRNFTMNTKDPHVD
CYTVSSIKSKLGLDRDALVGLAVLLGCDYLPKGVPGVGKEQALKLLQILKGQSLLQRFNQ
WTEEPGYSVPQSAAKKVVHCSVCSHPGSPKDHERNGCTLCKSDRYCEPHDYEYLCPCEWH
QTDHNRQLNEIENNIKKKACSCEGFPFHEVIQEFLSNKNKLLKPIRYQRPDLLLFQRFTV
QKMEWPSHYACEKLLVLLTRYDMIERKLGRKTSNQLQPIRIVKPRIRNGVCCLEIEWEKP
EHYSVEDTQPGGLDLLTIEEASLFEAAYPEVVAIYQKQQSETKGKKQKNIKIKPKGSHLP
ESDDVISSQSLITLEPISKAFPKQNPKFDLEISPDPILAQESTSPSLSSFVSPENALGLN
LQEQLMPSPRTLAVKQTKDVSNFLVSECSQPSSSSHNISVITDLHLSTIDWAGTSFSNSP
AVQRNTFSQDLQSEPESSAILPAFEQLSYESEQCTLSNKVSNRGLQKSGPEEHLLSSITG
LHLHDLPLKERIHIKSSCPQYNVGADADLESLPLTMNHSCIAYSSSGGSSHFSKDLTGVY
LQKELRNSKVLDSHFLQENFRVNTSLPYSFNDEAVKTSSLQVGLPTAAVPHNPKVDVKTK
NLVKKSSVCLKRDSSDEENAAVSWKAKYTAPKLKHSSHNHSLVHDRDSTHNKHRNPKDES
NETKLCTESFKIAEDEENKFSDPARNPQSFLQCHNKDEDSADCWESPLPLRQRLKLRFQN
TQSRLYNT
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaatgacctgtggcaaattttggagcctgtaaagcaacatatccacttgcag
gatctttgtgggaagaccattgccgttgatttgagtctctgggtatgcgaggcacagaca
gtgaagaaaatgattggaactgtcatgaagccccacctcaggaacctattttttcgtatt
tcatatttaactcaaatgaatgtaaaactggtgtttgtgatggaaggggagccaccaaag
ctgaaagctgatgtcatgaacaagaggactcagactcgatacgggccttctggaaaatcg
aggtctcagaaaacagggagatcgcattttaagtcagtcttacgagagtgccttgaaatg
ctagagtgcctaggaatgccctgggtccaggctgcgggggaagctgaggccatgtgtgct
taccttaatgccagcggccatgtggacggctgcctcaccaacgacggcgatgctttcctt
tatggagcccagactgtgtacaggaatttcaccatgaacacaaaggatccacatgttgac
tgttacacggtatcatctatcaagagtaagctaggcttggatcgagatgctctggtggga
ctggcggtacttcttggttgtgattaccttccgaagggagtgcctggagttggaaaagaa
caagcgttaaaacttttgcagattttgaaaggtcaaagtttgcttcagaggtttaaccag
tggactgaagaacctggctactctgttccacaatcagcagcaaaaaaagtggttcactgc
tcggtgtgttcccatccaggttctcctaaggatcatgaacgcaatgggtgcacactatgt
aaaagtgatagatactgtgaaccacatgattatgaatacctctgtccttgtgaatggcac
cagacagaccataataggcaactaaatgaaatagaaaacaatattaaaaagaaagcttgc
agttgcgaaggatttccattccatgaggtcatccaagaattcctttcgaataagaataaa
ctgttaaaaccgatcaggtaccaaagacctgatttattattgtttcagagatttactgtt
caaaaaatggagtggcccagtcactatgcgtgtgaaaaattgttggtgcttttgacccgc
tatgacatgatagaaagaaaacttggtagaaagacttccaatcaactacagccaattaga
attgttaaacctcgaatcagaaatggagtctgttgtcttgaaatagaatgggaaaagcct
gaacattattcggtagaagatacacaacctggaggactggatctccttacaatcgaagaa
gcatcactgtttgaagcagcctatcctgaagttgtagctatctaccagaaacaacagtca
gaaactaaagggaagaaacagaaaaatataaaaattaagcccaaaggaagccatctacca
gaatcagatgatgtgatcagttcccagtcacttattactttagaacctatatcaaaagcc
ttccccaagcagaatcccaaatttgatttggaaatttctccagatcctattttagcacag
gagtctacttctccctcattgagtagttttgtttcccctgaaaatgctcttggtttgaat
ttgcaagaacagttaatgccttctccaagaactttggctgtaaagcaaactaaagatgtc
agtaattttctagtttcagagtgtagtcagcccagttcttcatcccataatatttctgtg
attactgatctacacttgagtaccattgactgggcaggtacttcttttagtaattctcca
gcagttcaaagaaacactttctctcaagatttacaatcagaacctgaatcatcagccatc
cttcctgcctttgaacagttgtcatatgaatcagaacaatgtaccttaagcaacaaagtg
tccaatagaggtcttcagaagagtggtcctgaagagcatctcctttccagcatcactggt
ttacatcttcacgatttgcctctaaaggaaagaatacatataaaatcttcatgccctcag
tataatgtaggagcagatgctgacctggaaagtttacccctaacaatgaatcactcttgc
attgcttacagtagctctggtggttcatcccatttttcgaaggatcttacaggggtatat
cttcagaaagagctcagaaactctaaagttctagacagccacttccttcaagaaaacttc
agggtgaatacttccttaccttattctttcaatgacgaagcagtaaagacttccagtctt
caagttgggctgccaactgctgctgtacctcataatccaaaagttgatgtgaaaactaag
aaccttgtcaagaagagtagtgtttgcctcaagagagattcctcagatgaagagaatgct
gcagtgtcctggaaagctaagtatactgctcctaaattgaaacacagctctcataatcat
agcctagtccatgacagagacagtactcacaacaaacacagaaatccgaaagatgaatct
aacgaaaccaaactgtgtactgagtcttttaaaatagctgaagatgaagaaaacaagttc
tcagatccagcaagaaatccccagagttttctacaatgtcataacaaggatgaggactct
gctgactgctgggaaagtcctctccctttacgccagaggttaaagctcaggttccagaac
actcaaagtagactttataatacttaa

DBGET integrated database retrieval system