KEGG   Rattus norvegicus (rat): 298894
Entry
298894            CDS       T01003                                 

Gene name
Mycn, N-myc, Nmuc1, Nmyc
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog
  KO
K09109  N-myc proto-oncogene protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    298894 (Mycn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    298894 (Mycn)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    298894 (Mycn)
SSDB
Motif
Pfam: Myc_N HLH CENP-B_dimeris FAM176
Other DBs
NCBI-GeneID: 298894
NCBI-ProteinID: NP_001013114
RGD: 1584995
Ensembl: ENSRNOG00000051372
UniProt: Q63379
Position
6q15
AA seq 462 aa
MPSCTASTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRAFPEHSPEPSNWATEMLLPEADLWGNPAEEDAFGLGGLGGLTPNPVILQDCMWSG
FSAREKLERAVNEKLQHGHGPPGASSSCPAPGVGASSSGGRALGGSASAGRTGATLPTDL
SHPAAECVDPAVVFPFPVNKRESASVPAAPTSAPATSAVVTSVSVPAVAPVAAPARGSGR
PANSGEHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNNKAVTTFTITVR
PKTSALGLGRAQPGELILKRCVPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSV
VPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVI
LKKATEYVHALQANEHQLLLEKEKLQARQQQLLKKIEHARTC
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcccagctgcaccgcgtccaccatgccggggatgatctgcaagaacccagacctcgag
tttgactccctgcagccctgcttctacccggacgaagatgacttctacttcggcggtccc
gactcgaccccaccaggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ttgtcgcccagccgcgccttcccagagcacagcccggagccctcaaattgggccacggag
atgctgctgccggaggccgacctgtggggcaacccggccgaggaggatgcgtttggtctg
gggggactgggtggcctcactcctaatccggtcatccttcaggactgcatgtggagcggc
ttctctgcccgcgagaagctggagcgcgcagtgaacgagaagctgcagcacggccacggg
cccccgggagccagctcatcctgtccggctccgggagtgggtgccagtagctccgggggc
cgtgcccttggtgggtcggcgagtgctggtcgcaccggggccaccctgcctaccgacctt
tcccacccggctgcggagtgtgtggatcccgccgtggtcttccccttcccggtgaacaag
cgagagtcggcttcggtgcccgctgccccgaccagtgccccggcgaccagcgctgtggtc
actagtgtgtctgtcccggctgtagccccggtggctgctcctgctcgtggcagcggtcgt
cctgccaacagtggcgagcacaaggccctcagcacctctggagaggataccttgagcgac
tcagatgatgaagacgatgaggaggaagatgaagaggaggagatcgatgtggtcacggta
gagaagagacgctcctcctctaacaacaaggcagtcaccactttcaccatcactgtacgc
cccaagacctcggctctgggcctggggcgagcacaacctggcgagctgatcctcaagcgc
tgtgtccccatccatcagcaacacaactatgccgcaccctcaccctatgtggagagcgag
gatgcgccaccacagaagaagatcaagagcgaggcttctccacgccccctcaaaagtgtc
gttccaccaaaggctaagagcttgagcccccgaaactcagactcggaggacagcgagcgc
cgccgaaaccacaacatcctggagcgccagcgccgcaacgacctgcgctccagcttcctg
acgctcagggaccatgtgcccgagctggtgaagaacgagaaggccgccaaggtggtcatc
ttaaaaaaggccaccgagtacgtccacgccctacaggccaacgagcaccagctcctgctg
gaaaaggagaaactgcaggcgaggcagcagcagttgctaaagaagatcgaacacgctcgg
acttgctaa

DBGET integrated database retrieval system