KEGG   Rattus norvegicus (rat): 298906Help
Entry
298906            CDS       T01003                                 

Gene name
Pqlc3, RGD1306818
Definition
(RefSeq) PQ loop repeat containing 3
  KO
K23680  solute carrier family 66, member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    298906 (Pqlc3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC66: Lysosomal lysine-arginine transporter
   298906 (Pqlc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PQ-loop
Motif
Other DBs
NCBI-GeneID: 298906
NCBI-ProteinID: NP_001030124
RGD: 1306818
Ensembl: ENSRNOG00000005126
UniProt: G3V6N5 Q66HG2
Position
6q16
AA seq 202 aa AA seqDB search
MEAGLLWFCNWSTLGVCAALKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYG
NPLLTYLEYPILIVQDIVLLLFVFHFNGNVKQALPYMAVFVSSWFILSLQKWIIDLAMNL
CTVISAASKFAQLQYLWKAQDSGAVSALTWGLSAYTCATRIITTLMTTNDLTILLRFVIM
LALNIWVTATVLHYRKSVTKAE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgggctgctatggttctgcaactggagcacgctgggcgtgtgcgccgcactc
aaactgccgcagatctacgcgcagctggcggcgcgcagcgcacgagggatcagcctccct
agtttacttttggagctggccgggttcctggtcttccttcgttatcaacattactatggg
aacccactgctcacctacctggaataccccattctcatcgtacaagacattgtcctcctg
ctcttcgtctttcatttcaatgggaacgtgaagcaagccttgccgtacatggctgtattt
gtgtcttcttggttcatcctcagcctgcagaaatggatcatcgacttggccatgaactta
tgcacagtcattagtgcagccagtaagtttgcccagctccagtatttgtggaaggcacaa
gattcgggagctgtgagtgcactgacatggggcctctccgcctacacctgtgcaacaaga
ataataacaactttaatgaccactaatgacctgacaattcttctacgttttgtgatcatg
ttggctttaaatatatgggtaacagcaacggtacttcactaccggaagtctgtcaccaaa
gctgaatga

DBGET integrated database retrieval system