KEGG   Rattus norvegicus (rat): 298933
Entry
298933            CDS       T01003                                 

Gene name
Rnaseh1
Definition
(RefSeq) ribonuclease H1
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    298933 (Rnaseh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    298933 (Rnaseh1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     298933 (Rnaseh1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    298933 (Rnaseh1)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     298933 (Rnaseh1)
   Elongation factors (archaeal)
     298933 (Rnaseh1)
SSDB
Motif
Pfam: RNase_H Cauli_VI RVT_3
Other DBs
NCBI-GeneID: 298933
NCBI-ProteinID: NP_001013115
RGD: 1309012
Ensembl: ENSRNOG00000008584
UniProt: Q5BK46
Position
6q16
AA seq 285 aa
MRWLLPLFRTVTLAVVRVRRGVCGLGMFYAVRRGRRTGVFLSWSECKAQVDRFPAARFKK
FATEDEAWAFVRSSSSPDGSKGQESAHVQKLQVKTSKRPREPLGEEEEPPEPGAKHTRQD
TEPAALVSKDAFSYMGESVVVYTDGCCSSNGRKRARAGIGVYWGPGHPLNVGIRLPGRQT
NQRAEIHAACKAITQAKAQNISKLVLYTDSMFTINGITNWVQGWKKNGWRTSTGKDVINK
EDFMELDELTQGMDIQWMHIPGHSGFVGNEEADRLAREGAKQSEG
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcgctggctgctgccgctgtttcgcactgtgacactggccgtagtgcgcgtcaggcga
ggtgtttgcgggctcggcatgttctatgcggtgaggagaggccgcaggaccggggtcttc
ctgagttggagtgagtgcaaagcacaggtggaccggttccctgctgccaggtttaagaaa
tttgccacagaagatgaggcctgggcctttgtcaggagctcttccagtccggacggttca
aaagggcaggagagtgcgcatgtgcaaaagttacaggtgaagaccagcaagcggcctcgg
gagcctctgggtgaagaggaggaacctccagagccaggggcaaagcacacaagacaggac
acggagccagctgctctagtgagcaaggatgcattttcttatatgggagagtcagtcgtt
gtctacacggatggctgttgctccagtaatgggcggaagcgggcacgagcaggaatcggc
gtttactgggggccaggccaccccttaaatgtaggcataaggcttcctgggcgacagaca
aaccagagggctgagatccatgcagcctgtaaagccatcacgcaagccaaggctcagaac
atcagcaagctggtcctgtacacagacagcatgttcaccatcaacgggataactaactgg
gttcagggctggaagaagaatggctggagaacgagtacagggaaagacgtgatcaacaag
gaggacttcatggagctggatgagctcacccagggcatggacatccagtggatgcacatt
cctggccactcaggatttgtgggcaacgaagaagctgacagactggcaagggaaggagcg
aagcaatctgagggctga

DBGET integrated database retrieval system