KEGG   Rattus norvegicus (rat): 298934
Entry
298934            CDS       T01003                                 

Gene name
Adi1
Definition
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    298934 (Adi1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     298934 (Adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     298934 (Adi1)
SSDB
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_8 Cupin_3 DMSP_lyase
Other DBs
NCBI-GeneID: 298934
NCBI-ProteinID: NP_954528
RGD: 727828
Ensembl: ENSRNOG00000008950
UniProt: Q562C9
Position
6
AA seq 179 aa
MVQAWYMDESTADPRMPHRAQPDRPVGLEQLRTLGVLYWKLDADKYENDPELEQIRKTRN
YSWMDIITICKDSLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISME
KGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYVKFLEGTA
NT seq 540 nt   +upstreamnt  +downstreamnt
atggtgcaggcctggtatatggacgagtccacggccgacccgcggatgccccaccgcgca
cagcccgaccgccctgtgggactggagcagctgcgcacgctcggagtgctctattggaag
ctagatgcggacaagtatgagaatgatccagaactggaacagattcggaaaacaaggaac
tactcatggatggatatcatcaccatatgcaaagattcacttcccaattatgaggagaag
atcaagatgttctttgaggaacatctgcatctggatgaggagatccgctacatcctggag
ggcagcgggtacttcgatgtcagggacaaggaggacaagtggatccggatttctatggag
aagggggacatgatcacgcttcctgccggcatttatcaccgcttcacgctggacgagaag
aactacgtgaaggccatgcggctgtttgttggagaacctgtatggacaccatacaaccgg
ccagctgaccattttgatgcccgggtacagtacgtgaagtttttggaaggaacagcatag

DBGET integrated database retrieval system