KEGG   Rattus norvegicus (rat): 298944
Entry
298944            CDS       T01003                                 

Gene name
Gpr22
Definition
(RefSeq) G protein-coupled receptor 22
  KO
K04319  G protein-coupled receptor 22
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    298944 (Gpr22)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    298944 (Gpr22)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 298944
NCBI-ProteinID: NP_001100192
RGD: 1310848
Ensembl: ENSRNOG00000008423
UniProt: D4A3U0 A0A5H1ZRU0
Position
6q16
AA seq 469 aa
MSKLSMTSCINLWKTTMVSQKAHKATANRGNTNCSKRMCFSPVLEINMQSESNVTVRDDI
EDIDTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMKSNLISSVSNIITMN
LHVLDVIICVGCIPLTIVILLLSLERNTALICCFHEACVSFASVSTAINVFAITLDRYDI
SVKPANRILTMGRAVMLMTSIWIFSFFSFLIPFIEVNFFSLQSGNAWENKTLLCVSTSEY
YTELGMYYHLLVQIPIFFFTVIVMLITYTKILQALNIRIGTRFSTGQKKKARKKKTISLT
THETTDMSQSSGGRNVVFGVRTSVSVIIALRRAVKRHRERRERQKRVFKMSLLIISTFLL
CWTPISVLNTTILCLGPSDLLVKLRLCFLVMAYGTTIFHPLLYAFTRQKFQKVLKSKMKK
RVVSIVEADPMPNNAVIHNSWIDPKRNKKVTYEDSEIREKCLVPQVVTD
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgtcaaaattgtcaatgacatcatgtatcaatttgtggaaaactaccatggtgagccaa
aaggcccataaagcaacagcgaacaggggaaataccaactgctccaaaagaatgtgtttt
tctcctgttctggaaatcaacatgcagtctgaatcaaacgtcacggtgcgagatgacatt
gaggacatcgataccaatatgtaccaaccactgtcatacccattaagctttcaagtgtct
ctcactggatttctcatgttagaaattgtgctggggcttggtagcaaccttaccgtactg
gtactttactgcatgaaatccaacttaatcagctctgtcagtaacattatcacaatgaat
ctccatgtacttgatgtaataatctgtgtgggatgtattcctctaaccatagtgatcctt
ctgctctcactggagaggaacactgctctcatctgctgtttccacgaagcttgtgtttct
tttgcaagtgtttccacagcaatcaacgtttttgctattactctggacagatatgacatc
tctgtaaaacctgcaaacagaattctgacaatgggcagagctgtgatgctaatgacgtcc
atttggattttttctttcttctcattcctgattcccttcattgaagtcaattttttcagc
cttcaaagtggaaatgcgtgggaaaacaagacactgctgtgtgtcagcacaagtgagtac
tacactgagctcgggatgtactatcacctcctagttcagatccccatcttcttcttcaca
gttatcgtgatgctgatcacatacaccaagatactccaggctcttaatatccggataggc
actagattctcaacaggccagaagaagaaagcccggaagaaaaagacaatctctctaacc
acacatgagaccacagacatgtcgcaaagcagtggtgggaggaatgtcgtatttggtgtg
agaacttcagtttctgtaataattgccctccggcgagccgtgaaacgacaccgggaacga
cgagagaggcagaaaagagtcttcaaaatgtcgttattgattatttctacatttcttctc
tgttggacaccaatttctgttttaaataccaccattttatgtttaggcccaagtgacctt
ttagtaaaattaagattgtgttttctagtcatggcttatggaacaactatattccatcct
ctcctgtatgcattcaccagacaaaaatttcaaaaggtcttaaaaagtaagatgaaaaag
cgagttgtttccatagttgaagctgatcccatgcctaataacgctgtaatacacaactca
tggatagatcctaaaagaaacaaaaaggttacctacgaagacagtgaaataagagagaaa
tgtttagtacctcaggttgtcacagactag

DBGET integrated database retrieval system