KEGG   Rattus norvegicus (rat): 298947
Entry
298947            CDS       T01003                                 

Gene name
Pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04725  Cholinergic synapse
rno04921  Oxytocin signaling pathway
rno05132  Salmonella infection
rno05145  Toxoplasmosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    298947 (Pik3cg)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    298947 (Pik3cg)
   04072 Phospholipase D signaling pathway
    298947 (Pik3cg)
   04022 cGMP-PKG signaling pathway
    298947 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    298947 (Pik3cg)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    298947 (Pik3cg)
   04062 Chemokine signaling pathway
    298947 (Pik3cg)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    298947 (Pik3cg)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    298947 (Pik3cg)
  09156 Nervous system
   04725 Cholinergic synapse
    298947 (Pik3cg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    298947 (Pik3cg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    298947 (Pik3cg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    298947 (Pik3cg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    298947 (Pik3cg)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     298947 (Pik3cg)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    298947 (Pik3cg)
SSDB
Motif
Pfam: PIK3CG_ABD PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 298947
NCBI-ProteinID: NP_001358229
RGD: 1306468
Ensembl: ENSRNOG00000009385
Position
6
AA seq 1102 aa
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLD
CLRYWKMMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRL
VTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIVNNCIFIVIHRGTTSQTIKVSADDT
PDTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRNEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKLFTEEVLWNVWLEFGIKI
KDLPKGALLNLQIYCCKTPSLSSKASVETPGSESKGKAQLLYYVNLLLIDHRFLLRHGGY
VLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGKAMLQDFTQQVHVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLESLQNSSLP
ESFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKRADPTVLSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWEAESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDVCVRAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALMVGRSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagaactatgaacaacctgtggttctgagagaggacaacctccgcaggcgc
cggaggatgaagccacgcagcgcagcaggcagcctgtcttccatggagctcatccccatt
gagttcgtactgcccaccagccagcgcatcagcaagacaccggaaacggccctgctgcat
gtggctggccacggcaatgtggagcagatgaaagctcaggtgtggttacgcgcactggag
accagtgtggctgcggaattctaccaccgattaggtccggaccaattcctcctcctctac
cagaagaagggacagtggtatgagatctacgataggtaccaagtggtgcagaccctagac
tgcctacgttactggaagatgatgcacaagagccccggccagatccacgtggtacagcga
catgtaccttctgaggagaccctggctttccagaagcagctcacctccctgattggctac
gacgtcactgacatcagcaacgtgcacgatgatgagctagaattcactcgccgccgtctg
gttacgccccgcatggctgaagtggctggccgggatgccaaactctatgccatgcaccct
tgggtgacctccaaacctcttccagactacctgtcaaaaaaaattgtcaacaattgcatt
ttcattgtcatccatcgtggtaccaccagtcaaaccatcaaggtctccgcagatgatact
cctgacaccatccttcagagcttcttcaccaagatggccaagaagaagtccctaatgaat
atcccagaaagtcaaagtgagcaggattttgtgctgcgggtctgtggccgtgatgagtac
ctagtaggtgaaacgcccctcaaaaatttccagtgggtgaggcagtgcctcaagaacgga
gaggaaatacacctggtgctcgacacgcctccagacccggccctagatgaggtgaggaac
gaagaatggccgctggtggatgactgcactggagtcaccggctaccatgagcagctgacc
atccatggcaaggaccacgagagcgttttcacagtgtctttgtgggactgtgaccgaaag
ttcagggtcaagatcagaggcattgatatccctgtcttgcctcggaacaccgacctcact
gtttttgtggaagcaaatatccagcatgggcaacaagtcctctgccaaaggagaaccagc
cctaagctcttcacagaagaggtgctctggaatgtgtggctggagtttggcattaaaatc
aaagacttgcccaaaggggccctactgaacctacagatctactgctgcaaaaccccatca
ctgtccagtaaggcttccgtagagacgccaggctccgagtccaagggcaaagcccagctc
ctctattacgtgaacttgctgttgatagaccaccgcttcctcctccgccatgggggctac
gtgctccacatgtggcagatatctgggaaggcagaggaacagggcagcttcaatgccgac
aagctcacctccgcaaccaatcctgacaaggagaactcaatgtccatttccatcttgctg
gacaactactgtcaccccattgctttgcctaagcaccggcctactccggacccagaagga
gacagagttcgagctgaaatgcccaatcagcttcgaaagcaattggaggcaatcatagcc
acagatccacttaaccccctcacagcagaggacaaagaattgctctggcattttagatat
gaaagcctgaagcatccaaaggcataccctaaactattcagctcagtaaagtggggacag
caagaaattgttgccaaaacataccagctattagccagaagggagatctgggatcaaagt
gctttggatgttggcttaaccatgcaactcctggactgcaacttttcagatgaaaacgta
agggccattgcagttcagaaactggagagcttggaggacgatgacgttttacattacctt
ctccagctggtgcaggctgtgaaatttgaaccataccatgacagtgcgctggccagattc
ttgctgaagcgtggcttgagaaacaagagaattggtcacttcttattctggttcttgcga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgatcctggaagcgtac
ctgcgcggctgtggcaaggccatgctacaggacttcacgcagcaggtccacgtgattgag
atgttacagaaagtcaccattgatatcaaatcactctcggctgagaagtatgatgtcagt
tcccaagttatttcacagcttaagcaaaagcttgaaagcctgcagaattccagtcttcct
gagagctttagagttccctatgatcctggactgaaagcaggtaccctggtgattgagaag
tgtaaagtgatggcctccaagaagaagcccctgtggcttgagtttaaacgtgccgatcct
acagtcctatccaatgaaaccattgggatcatctttaaacatggcgacgatctacgccaa
gacatgttgatcttacagattctacgcatcatggagtccatttgggaggctgaatctctg
gacctgtgccttctgccttacggttgcatctcaactggtgacaaaatagggatgatagag
attgtgaaggacgccacgacgattgctcaaattcagcagagcacggtgggtaacacgggg
gcattcaaagatgaagtcctgaatcactggctcaaggaaaaatgccctattgaagaaaag
tttcaggcagcagtggaaaggttcgtttactcctgtgcaggctactgtgtggccacattt
gttcttgggataggtgacaggcacaacgacaacatcatgatctcagagacaggaaaccta
tttcacatagactttggacacattcttggcaattacaagagtttcctgggcatcaataaa
gagagagtaccttttgtcctaaccccggacttcttgtttgtgatgggaacttcgggcaaa
aagacaagtccacacttccagaaattccaggatgtctgcgttagggcttacctagctctt
cgccaccacacaaacctgctgatcatcctgttctccatgatgctgatgacaggaatgccg
cagctgacaagcaaagaggacattgaatacatccgggatgccctcatggtggggagaagc
gaggaggacgccaagaagtatttccttgatcagattgaagtctgcagggacaaaggatgg
actgtgcagtttaactggttcctccatcttgttcttggcatcaagcaaggagagaaacac
tccgcttga

KEGG   Rattus norvegicus (rat): 497931
Entry
497931            CDS       T01003                                 

Gene name
Pik3r5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04725  Cholinergic synapse
rno04921  Oxytocin signaling pathway
rno05145  Toxoplasmosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    497931 (Pik3r5)
   04072 Phospholipase D signaling pathway
    497931 (Pik3r5)
   04022 cGMP-PKG signaling pathway
    497931 (Pik3r5)
   04151 PI3K-Akt signaling pathway
    497931 (Pik3r5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    497931 (Pik3r5)
   04062 Chemokine signaling pathway
    497931 (Pik3r5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    497931 (Pik3r5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    497931 (Pik3r5)
  09156 Nervous system
   04725 Cholinergic synapse
    497931 (Pik3r5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    497931 (Pik3r5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    497931 (Pik3r5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    497931 (Pik3r5)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    497931 (Pik3r5)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 497931
NCBI-ProteinID: NP_001178852
RGD: 1563261
Ensembl: ENSRNOG00000023428
UniProt: D4A4I3
Position
10
AA seq 872 aa
MQPAATTCTEDRIQHALERCLHGLSLGRRSAPWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTQEVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAASTYHCFLTWPVPYC
SICREMLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAD
KLSTPGQSPHGAYTTLLLHAFQATFGTHCDLPKLHRKLQSKTLEELEDIFTETTEAQELA
SGIGDVAEARQWLRTKLQAVGEKAGFPGILDTASPGKLHTIPIPVARCYTYSWNQDSFDI
LQEVLLKEQELLQPGILGDDEEEEEEDLEIDRHIAERDSLLSTGSLVSHDSELLLTSSQA
SGPVLSRQVLTTFVSGLSDGMDSGYVEDSEESSSEWPKKPGSQQRQGHRRPRQKFNRFYK
LLKSTSQLVLRRDSRSLECSPDPTLPLRRAGSLSSPLDFPTQLPSRAQRSRSLPQPKLST
QLPSWLLAPPSHHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLENSHP
ILTRFFKLQFFYVPVKRSHGASSSACLSSLNQASPLLPDSLKHPSPADLGKAPWEDSTND
ISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSATQLPILADMLLYYCRFA
ARPVLLQVYQTELTFVTGEKTTEIFIQSLELGHSATTRAIKASGPGSKRLGIGDDREAVP
LTLQIIYSKGAISGRSRWSNLEKVCTSVNLSKACQKPEELDSSMEALTLTLTEVVKRQNP
KSKKGFNQISTSYIKVDKVQIISSSSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSSL
PPEGSLSQPAEAGSDLCSLLCLPIMTFSGALP
NT seq 2619 nt   +upstreamnt  +downstreamnt
atgcagccagcagccacaacgtgcacagaggaccgcatccagcacgctctggagagatgc
ttgcatggactgagcctcggacgccgttctgctccctggtcagccgggctgtgtctgaac
tgctggagcctacaggagctggtcagcagggacccgggccacttcctcatcctcctggaa
cagatcctgcagaagacccaagaggtccaagagaagggcacctatgacctcctcgcccct
ctggctctgctcttctattccactgtcctctgcactccacacttcccaccagactcagac
ctcctgctgaaggcagccagcacctaccactgcttcctgacctggccggttccctactgc
agcatctgccgagagatgctcaccttcatcgatgctgagctcaaggccccaggaatctcc
taccagcggctggtgagggctgaacagggcctgcccatcaggagccaccgaagttccact
gtcactgtgctgttgctgaacccggtagaggtacaggctgagttcctcgctgtggcagac
aagctgagcacaccgggacagtcaccccatggcgcctacaccaccctgctcctgcatgcc
ttccaggccacctttgggacccactgtgaccttcctaaactgcaccgcaaacttcagtcc
aagacgctagaagagctcgaggacatcttcactgagactacagaagcccaggagctggca
tctggcattggggatgtagcagaggcccgtcagtggctccggaccaagctgcaggcagtg
ggagaaaaagccggcttccccgggatcttagacactgcaagccctgggaaactccacacg
attcccatccctgtcgccagatgctacacttacagctggaatcaggacagctttgacatc
ctacaggaagtccttctcaaggagcaggagttgctgcagccagggatcctgggagatgat
gaagaggaggaagaggaggacttggagattgacaggcatattgctgagagggactccctg
ctctccacaggctctctggtgtctcacgactccgaactgttgcttacctcctctcaggcc
tcaggaccagtgctgtcccgccaggtgctgaccacctttgtctcaggcctctcggatggc
atggacagtggctacgttgaggacagtgaggaaagctcctcagagtggcccaagaagccg
ggcagccagcagcgccagggtcaccgcaggcctaggcagaagttcaacaggttctataaa
cttttaaagagcaccagccagttggtcctgaggagggactctcggagtctggaatgcagc
ccagacccaaccctgcctctgcggcgggcagggagcctcagcagccccttggactttccg
acccagctcccttccagggctcagcgctcacggtccctaccccagcccaagctcagcacc
caactacccagctggcttctggcaccaccctcacaccaccagcgccgccgtcccttcctc
agcggggatgaggaccccaaggcttccacactacgggttgtggtctttggctctgaccgg
atctcagggaaggtggcccgggcctatagcaagctcaggcggctggagaacagtcacccg
atcctcacccggttcttcaagcttcagttcttctacgtacctgtgaagagaagccacgga
gccagctctagtgcctgcctatcctctctgaaccaggcatctccactccttccagactcc
ttgaagcaccccagccctgcagaccttggcaaggccccatgggaggacagtaccaatgac
atctctcactacctcggtatgcttgacccttggtatgaacgcaatgtgttgggcctcatg
catctgcctcctgaagtcctgtgtcagcagtccctcaaggcagaatctcggcccctggag
ggctcggccacccagctgcccatcctggccgatatgttactctactactgccgctttgca
gcccgcccagtgttgctgcaggtttatcagacagagctgaccttcgtcaccggggagaag
accacggagatctttatccagtctctggagctgggtcactctgcgaccactcgtgctatc
aaggcttcaggtccgggaagcaaaaggctgggcattggcgatgaccgggaggccgtccct
ctaacactacagattatttacagcaagggagccatcagtgggcgaagccgctggagcaac
ctagagaaggtctgcacctctgttaacctcagcaaggcctgccagaagccggaggaacta
gattccagcatggaggcgctgacgctaaccctgacagaagtggtgaagaggcagaaccct
aaatccaaaaagggctttaaccagatcagtacatcctacatcaaagtggacaaggtgcag
atcatcagctccagcagctgcccctttgctgtgtgtctagaccaggatgagaggaagatc
ctgcagagtgtggtcaggtgtgaagtgtcaccctgctacaagccagagaagagcagcctg
ccacctgaggggtccctcagccaaccagcagaggctgggtctgacctgtgctcccttctc
tgccttcccatcatgactttcagtggtgctctgccctag

KEGG   Rattus norvegicus (rat): 497932
Entry
497932            CDS       T01003                                 

Gene name
Pik3r6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04611  Platelet activation
rno04725  Cholinergic synapse
rno04921  Oxytocin signaling pathway
rno05145  Toxoplasmosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    497932 (Pik3r6)
   04072 Phospholipase D signaling pathway
    497932 (Pik3r6)
   04022 cGMP-PKG signaling pathway
    497932 (Pik3r6)
   04151 PI3K-Akt signaling pathway
    497932 (Pik3r6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    497932 (Pik3r6)
   04062 Chemokine signaling pathway
    497932 (Pik3r6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    497932 (Pik3r6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    497932 (Pik3r6)
  09156 Nervous system
   04725 Cholinergic synapse
    497932 (Pik3r6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    497932 (Pik3r6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    497932 (Pik3r6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    497932 (Pik3r6)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    497932 (Pik3r6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 497932
NCBI-ProteinID: NP_001074913
RGD: 1560850
Ensembl: ENSRNOG00000003992
UniProt: A2TJT9
Position
10
AA seq 756 aa
MESSDVELDFQRSVQAVLRELNTPNPALQSNQGMWRWSLHKKMERNPGKSSVLVRILLRE
LEKAESEDARRVIIPLLLTLMSVLTKATGITEDLYHRAYTFCTRLLTLPAPYSTVALDCA
IRLKTETAVPGTLYQRTVIAEQNLISELYPYQERVFLFVDPELVSASVCSALLLEIQAAQ
EQQTPEACMRHVVSHALQAALGEACHTGALNRKLQASSRRVLEYYFHAVVAAIEQVASED
SPSRLGHLERMEEIYCSLLGTATTRRRCVGDLLQDRLPSIPLPSPYITFHLWTDQEQLWK
ELVLFLRPRSQLRLSADLDALDLQGFRPDRDLARVSTDSGIERDLPLGNDELPDPSSSEM
ERAALQRKGGIKKRVWPPDFFMPGSWDGPPGLHRRTGRPSGDGELLPGVSRVHTARVLVL
GDDRMVGRLAQAYYRLRKRETKKFCLTPRLSLQFYYIPVLAPQGTGQDPEASRKPELGEL
ASFLGRVDPWYESTVNTLCPAILKLAEMPPCLDTSRTVDPFILDVITYYVRMGTQPIYFQ
LYKVKIFTNLSHDPIEDIFLMELKVKTQDSKSPKEGSSPRRRGAAEGTGAELSMCYQKAL
LSHRPREVTVSLRATGLVLKAIPAGDTEVSGFSHCTSPNAASAADCSCLHVSVTEVVKTS
NLAGRSFTTSTNTFRTSSIQVQSQDQRLLTLWLDKDGRRTFRDVVRFEAGPCPEPCSRAQ
KSKMSAFNSHGQETEKSMTKPNSLLMPINTFSGIIQ
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggacttccagaggagtgtacaggctgtgctgcgagag
ctcaacaccccaaacccagccctccagagtaatcagggcatgtggagatggtctctgcac
aagaagatggagagaaatccaggaaagagctccgttctggtccgaattctgctcagagag
ctggagaaggcagaaagcgaggacgcacggcgtgtcatcatacccttgctgctcactcta
atgtcagtgctcactaaggcgaccggcatcacggaagatctataccatagagcttacacc
ttctgcaccaggctgctgaccttgccagccccctactctacagtcgccttggactgtgcc
ataaggctgaaaacagagacggctgtcccaggtacgctgtatcagcggactgtcattgcg
gagcagaacctgataagtgagctctacccttaccaggagagagtgtttctgtttgtggac
cccgagctggtttctgcctccgtgtgcagtgccctgctgctggagatccaggcagcccaa
gagcagcagacacccgaggcctgcatgcgccacgtggtctcccatgccttacaggcagct
ctgggagaagcctgtcacacaggtgctctgaacaggaagctgcaggccagctcccgtcgc
gtactagaatactatttccacgctgtcgtggctgccatagagcaggtggctagcgaggac
agccccagccggctgggacacctggagaggatggaggagatttactgctcgctgctagga
actgcgaccacaagaaggcgctgcgtcggtgacctcctccaagaccgactgccaagcatc
cccctgcccagtccctacatcaccttccacctgtggactgaccaggagcagctctggaaa
gaactggtactcttcctccgcccacgctcccagctccgtctcagtgctgatctggatgcc
ttggatctacaaggatttaggccagaccgggacttggcccgggtgtccaccgacagtgga
attgaacgggaccttcctttggggaacgatgagctcccagaccccagcagctctgagatg
gagcgagctgcacttcaacgcaaggggggcatcaagaagcgtgtgtggccccctgacttc
ttcatgcccgggagctgggatggacccccagggttgcatcggaggactggaaggcctagt
ggggatggggagctgctacctggagtctccagagtgcataccgcccgcgtgctcgtgctg
ggggatgacaggatggtagggcgcttggcccaggcttactacagactcaggaaacgggag
accaagaagttctgcctcactcctagactcagcctacagttctactacatccctgtgctg
gcacctcaggggactggacaggatccagaagcatccaggaaacctgagctgggagagctg
gcttccttcctgggtcgagttgacccttggtatgaaagcactgtcaacaccctgtgtcct
gccatcctcaagcttgctgagatgcctccctgtttggacacatccaggaccgtggacccc
ttcatcctggatgtcatcacttactatgttcgcatgggcacccaacccatctatttccag
ctctacaaggttaagatcttcaccaacttgagtcatgaccctatagaggacattttcctc
atggagctgaaggtgaagacccaagattccaagtcccccaaagagggctcttcaccccga
aggagaggggcggctgagggcacaggagctgaactgtccatgtgctaccagaaggccctg
ctcagccacagacccagagaggtcactgtttctctgcgggccaccgggctggtcctgaag
gccattccagcaggtgacactgaagtttcagggttctcccactgtacctcaccaaatgct
gcttctgctgcagactgctcctgtctgcacgtcagtgtgacagaggtggtcaagacctcc
aatctggcaggaaggtcgttcacgacatcgacgaacaccttccgaacatccagtatccaa
gtccagagccaagaccagaggctgctcacactgtggctggacaaggatggccggcggact
ttcagggatgtggtcagatttgaggctggtccctgcccagagccatgttctcgggcccag
aaatccaagatgtcagcgttcaattcacatgggcaggagacagaaaagagcatgaccaaa
cccaattctcttctgatgcccatcaacacattctctggcatcatccagtga

DBGET integrated database retrieval system