KEGG   Rattus norvegicus (rat): 298961
Entry
298961            CDS       T01003                                 

Gene name
Agr2
Definition
(RefSeq) anterior gradient 2, protein disulphide isomerase family member
  KO
K20356  anterior gradient protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    298961 (Agr2)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    298961 (Agr2)
SSDB
Motif
Pfam: Thioredoxin_7 Thioredoxin_2
Other DBs
NCBI-GeneID: 298961
NCBI-ProteinID: NP_001100195
RGD: 1304606
Ensembl: ENSRNOG00000005023
UniProt: D3ZIA7
Position
6q16
AA seq 175 aa
MEKFSVSAILLLVAISGTLAKDTTVKSGSKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEE
ALYKSKTSNRPLMVIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLIYETTDKHLSP
DGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLHDNMKKALKLLKTEL
NT seq 528 nt   +upstreamnt  +downstreamnt
atggagaaattttcagtctcggcaatcctgcttcttgtggccatctctggtactctggcc
aaagacaccacagtcaaatctggatccaaaaaggacccaaaggactctcgacccaaacta
ccccagaccctgtccagaggttggggagatcagctcatctggactcagacttacgaagaa
gccttatacaaatccaagacaagcaacagacccttgatggtcattcatcacttggacgaa
tgcccgcacagtcaagctttaaagaaagtgtttgctgaaaataaggagatccagaaattg
gcagagcagtttgttctcctcaacttgatctatgaaacaactgacaagcacctttctcct
gatggccagtacgtccccagaattgtgtttgtggacccttccctgacggtgagggcagac
atcaccggaagatactcaaaccgtctctacgcttacgaaccttctgacacagctctgctg
cacgacaacatgaagaaagctctcaagttgctgaagacagagttgtag

DBGET integrated database retrieval system