KEGG   Rattus norvegicus (rat): 299012
Entry
299012            CDS       T01003                                 

Gene name
Arhgap5
Definition
(RefSeq) rho GTPase-activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    299012 (Arhgap5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    299012 (Arhgap5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    299012 (Arhgap5)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    299012 (Arhgap5)
SSDB
Motif
Pfam: RhoGAP_pG1_pG2 RhoGAP-FF1 Ras FF GTP_EFTU NOG1 Roc MMR_HSR1 U5_2-snRNA_bdg Cdh1_DBD_1
Other DBs
NCBI-GeneID: 299012
NCBI-ProteinID: NP_001041334
RGD: 1308507
Ensembl: ENSRNOG00000004696
UniProt: Q6TUE6
Position
6
AA seq 1245 aa
MAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTID
FGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAA
SKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVN
NLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTA
LVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNHP
DYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYISTLPRAFNTLLPDLEEIEHLNW
LEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQHL
ISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQRE
IVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRESL
LLKHIGFVYHPTKETCLSGQYCTDIKVENLLANSLLHSDHNRSRLYHDSTNIDKVNLFIL
GKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYILSQLWTAAFKPHGCFCV
FNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQL
ANKLQCPFVDVPAGTYPRKFNESQIKQALRGVLESVKHNLDVVSPVPINKDVSEADLRIV
MCAMCGDPFSVDIILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSIG
VRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELM
TEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQS
EDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPV
HSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLAH
PEDMDSSDNYAEPLDTIFKQKGYPDEIYVVPDDSQNRIIKIRNSFVNNTQGDEENGFSDR
TSKGHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFPTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQEVDDKKIKKKPHKVKEDKKGFVSKG
NT seq 3738 nt   +upstreamnt  +downstreamnt
atggcaaagaacaaagagcctcgacccccatcctatactgtcagtgtggttggactctct
gggactgaaaaagacaaaggaaactgtggagttggaaaatcttgtttgtgcaatagattt
gtacgttcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccattgac
tttggaggacgagtagtaaacaatgatcactttttatactggggtgacataacacaaaat
ggtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgatgat
cagactttcttgcctcatcgaagtacaaatttgcaaccatacataaaacgtgcagctgcc
tctaaattgcagtcagcagaaaaactgatgtacatttgcaccgatcagctaggcttggag
caagactttgaacagaagcagatgcctgaagggaaactcaatgtagatggatttttattg
tgtattgatgtgagtcaaggatgtaataggaagtttgatgatcaacttaaatttgtgaat
aacctttttgtccagctatcaaaatccaaaaagcctgtgataatagcagcaactaaatgt
gatgaatgtgtggatcattaccttagagaagttcaagcctttgcttcaaacaaaaagaac
cttctagtagtggaaacatcagcacgatttaatgtcaacattgagacatgtttcactgct
ttggtacaaatgttggataaaactcgtggcaaacctaaaattattccctatctggatgct
tataaaacacagagacaacttgttgtcacagcaacagacaagtttgaaaaacttgtacag
actgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaaccaccct
gattatgaagaatatatcaacttagagggaacaagaaaggccagaaatacattttcaaag
catatagagcaactcaaacaggaacatataagaaaaaggagagaagaatatataagtacc
ttaccaagggcttttaatactctcttgccagatctagaagagattgaacatttgaattgg
ttggaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtgcta
gaaaaaacaccttgggatgaaactgaccatatagacaaaattaatgatagacggatccca
ttcgaccttctgagcactttagaagcagaaaaggtctatcaaaaccatgtacaacatctg
atatcagagaaaagaagaatagaaatgaaggagaaattcaagaagactttagaaaaaatt
cagttcatttcacctgggcagccgtgggaggaagttatgtgttttgtcatggaggatgaa
gcattcaaatacatcactgaggctgatagcaaagaagtatatggtagacatcagcgagag
atagtagaaaaagccaaagaagagtttcaggaaatgctttttgagcattctgaacttttt
tatgatttagatcttaatgcaacaccaagttctgataaaatgagtgaaattcatacagtt
ctaagtgaagaacctagatataaagctttacagaaacttgcacctgatagagaatctctt
ctccttaagcacataggattcgtttatcatcccactaaagaaacatgcctcagtggccaa
tactgtacagacattaaagtggaaaacttacttgccaatagtctattacattcggatcat
aaccgctcacgcttgtatcatgatagtaccaatatagacaaagttaatcttttcatttta
gggaaagatggccttgcccaggaactagcaaatgagataaggactcaatccactgatgat
gagtatgccttagatggaaaaatttatgaacttgatcttcggcctgttgatgccaaatcg
ccttacattttgagtcagctatggactgcagcctttaaaccacatgggtgcttctgtgta
tttaattccatcgagtcactgagttttattggggagtttattggaaaaataagaactgaa
gcatctcagatcagaaaagataaatatatggctaatcttccatttacattaattcttgct
aatcagagagattccattagtaaaaatctaccaattctcaggcatcaaggtcaacagttg
gccaataaattgcagtgtcctttcgtcgacgtacctgctggtacgtatcctcgtaaattc
aatgaatcacaaataaagcaagctctacgaggagtattagaatcagttaaacacaattta
gatgtggtgagcccagttcctatcaataaggatgtgtcagaagctgacttgagaattgtc
atgtgtgccatgtgtggcgatccttttagtgtggatattattctttcacctttccttgac
tctcattcttgcagtgctgctcaagctggacagaataattcattaatgcttgacaaaatt
attggtgaaaaaaggaggcgaatacagatcacaatattgtcataccactcctcaattgga
gtaagaaaagatgaactagttcatgggtatatattagtttattctgcaaaaaggaaagca
tcaatgggaatgcttcgtgcatttctatcagaagttcaagataccattcctgtacaactg
gtggcagttactgacagtcaagctgatttttttgaaaatgaagctatcaaggagttaatg
actgaaggagaacacattgcaactgagataactgctaaatttacagcattatattcttta
tctcagtatcataggcaaactgaggtttttactttgtttttcagtgacgttctagagaaa
aaaaatatgatagaaaattcctatttgtctgataatacaagggaatccactcatcaaagt
gaagatgtttttcttccgtctccaagagactgctttccctacaacaactacccagattca
gatgatgacacagaagcaccacctccatatagtccaattggggatgatgtacagttgctt
ccaacacctagtgaccgttccagatacaggttagatttggaaggaaatgagtatcctgtt
catagcactccaaattgtcacgatcatgagcgtaaccataaagtgcctccacctattaaa
cctaaaccagtcgttcctaaaacaaatgtgaaaaaactggatccaaacctattaaaaacg
attgaagctggtattggtaaaaatccaagaaaacagacttctcgggtgcctttggcacat
cctgaagatatggattcctcagataactatgcggaaccccttgacacaatttttaagcag
aagggctatcctgatgagatttatgttgtcccagatgatagtcagaatcgaattattaaa
attcgaaactcatttgtaaataacactcaaggagatgaagaaaatgggttttctgataga
acctcaaaaggtcatggggaacgtaggccttcaaaatacaagtataagtctaaaactctg
tttagtaaagccaagtcatactatagaagaacacactcagatgcaagcgatgatgaggct
ttccctacttctaaaacaaaaagaaaaggaaggcatcgtggaagtgaagaagatccatta
ctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacatctgaccag
gaggtagatgataagaagataaagaagaaaccccacaaagtaaaagaagataaaaagggt
tttgttagcaaaggctag

KEGG   Rattus norvegicus (rat): 306400
Entry
306400            CDS       T01003                                 

Gene name
Arhgap35
Definition
(RefSeq) rho GTPase-activating protein 35
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    306400 (Arhgap35)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    306400 (Arhgap35)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    306400 (Arhgap35)
   04670 Leukocyte transendothelial migration
    306400 (Arhgap35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    306400 (Arhgap35)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    306400 (Arhgap35)
SSDB
Motif
Pfam: RhoGAP_pG1_pG2 RhoGAP RhoGAP-FF1 Ras FF Cdh1_DBD_1 NOG1 Hira
Other DBs
NCBI-GeneID: 306400
NCBI-ProteinID: NP_001258061
RGD: 1308738
Ensembl: ENSRNOG00000015852
UniProt: P81128
Structure
PDB: 
5IRC 6D4G

Position
1
AA seq 1499 aa
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVIVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKSHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEVDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDETSHIDNMENERIPFDLMDTVPAEQLYETHL
EKLRNERKRAEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDRAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDILSPVLQSQTCKSSHCGSSNSVLLELPIGVHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAIDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLELFHPFFKDVVEKKNIIEATHMYDNVAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDVEPPSYHLFREDATLPSLSKDHSKFSMELEGN
DGLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKDLSYLDQGHREGQRKSMSSSPWMPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSAVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYSMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
RVSHNNKVNLMTSENLSICFWPTLMRPDFSSMDALTATRSYQTIIELFIQQCPFFFYNRP
ISEPPGAAPGSPSAMAPTVPFLTSTPATSQPSPPQSPPPTPQSPMQPLLSSQLQAEHTL
NT seq 4500 nt   +upstreamnt  +downstreamnt
atgatgatggcaagaaagcaagatgtccgaatccccacctacaacatcagtgtggtggga
ttgtccggcactgagaaggagaaaggccagtgcggcattgggaagtcttgtctatgtaac
cgctttgtgcgcccaagtgctgatgagtttcacctggaccacacttctgtcctcagcacc
agtgactttggtgggcgggtggtcaataatgaccattttctgtactggggagaagttagc
cgctccctggaggactgtgtggaatgtaagatgcacattgtggagcagactgagtttatt
gacgatcagacttttcaacctcatcgaagcacggcactgcagccctacatcaagagagcc
gcagccaccaagcttgcttcagctgaaaaactcatgtatttttgcactgaccagctaggg
ctggagcaagactttgagcagaaacagatgccagatgggaagctgctggttgacggtttc
cttctgggcatcgatgttagcaggggcatgaacaggaacttcgatgaccagctcaagttt
gtctccaatctctacaatcagcttgcaaaaacaaaaaagcccatagtaatagtcctgacc
aagtgtgatgagggtgttgagcggtacattagagatgcacatacttttgccttaagcaaa
aagaacctccaggttgtagagacctctgcaaggtccaatgtgaatgtggacttggctttc
agcaccttagtgcaactcattgataagagtcgagggaagacgaaaatcatcccttacttt
gaagctctcaagcagcagagtcagcagatagctacagcaaaggacaagtatgagtggttg
gtgagccgcattgtgaaaagtcacaatgagaactggctgagtgtcagccgaaagatgcag
gcctcccctgagtaccaggactatgtctatctggaagggacacagaaagccaagaagctc
ttcctgcagcacattcaccgcctcaagcatgagcatattgagcgccggagaaagctgtac
ctggcagccctgccattggcttttgaagccctcatacctaatctagatgaagtagaccac
ctgagctgcattaaagcaaaaaagctgttagagactaagccagagttcttaaagtggttt
gttgtacttgaagagacaccatgggatgaaaccagccacattgacaacatggaaaatgag
cggattccctttgacttgatggatactgtccctgctgagcagttgtatgagacccacttg
gagaagctgaggaatgagaggaagagagctgagatgcgaagggctttcaaagaaaacctg
gagacctctcctttcataactcctgggaaaccttgggaagaagctcgtagttttattatg
aatgaagacttctaccagtggctggaagaatctgtgtacatggacatctatggcaagcac
caaaagcagattatagaccgggcaaaggaagagttccaagagttgcttttggagtattca
gaattgttttatgagctggagctggatgctaaacccagtaaggaaaagatgggtgttatc
caggatgttctgggtgaagagcaacgatttaaagcattgcagaaactccaagcagagcgt
gatgccctcattctgaagcacattcattttgtgtaccacccaacaaaggagacatgccca
agctgtccagcttgcgtagatgctaagattgaacatttgatcagttctcgctttatccga
ccatctgataggaatcagaagaactctttgtctgaccccaatattgataggatcaatttg
gttattttaggcaaagatggccttgcccgagagttagccaatgaaattcgagctctttgt
acaaatgatgacaagtatgtaatagatggtaaaatgtatgagctttctctgaggccaata
gaggggaatgttcggcttcctgtgaactctttccagacaccaaccttccaaccccatggc
tgtctctgcctttacaattcaaaggagtcgctgtcctatgtggtggagagtatagagaag
agcagagaatctacactgggcaggcgggataatcacttagtccacctccccttgacttta
attttagttaacaagagaggggacacaagtggagagactctgcacagcttaatacagcaa
ggccagcagattgctagcaaacttcagtgtgtctttcttgatcctgcgtctgctggcatt
ggttatggacgcaacattaacgagaagcagatcagtcaagttctgaagggactcctggac
tctaagcgcaacttaaacctggttagttctactgctagtatcaaagatttggctgatgtg
gaccttcgaattgtcatgtgtctcatgtgtggtgatccttttagtgcagatgacattctc
tctcctgtcctgcagtcccaaacttgtaaatcttcccactgtgggagcagcaactctgtt
ttacttgaacttccaattggagtacacaagaagcgcattgagctgtctgttctttcatac
cattcctcatttagcatccgaaagagccggttggttcatgggtacattgttttttattca
gccaaacgtaaggcctccttggcaatgttacgtgcctttctttgtgaagtgcaggatatt
atccccatccagcttgtcgcactcactgatggcgctatagatgtcctggacaatgactta
agtcgagagcagctaacagagggagaggaaattgcacaagaaattgatgggagattcaca
agcatcccttgtagccagccccagcataaactcgagctcttccatcccttttttaaagat
gtggtggagaaaaagaacataatcgaggccacacacatgtacgataatgtggctgaggcc
tgcagcaccactgaggaggtattcaactcccccagggctgggtcacccctctgcaattca
aacttacaggactcagaagaagatgtggagcctccatcgtaccacctttttcgggaagat
gcgacattgccctccctgtccaaagatcattccaagttctcaatggagctggagggaaac
gacgggctgtctttcataatgagcaactttgagagtaaactgaacaacaaagtacctcca
ccagtcaaaccaaagcctcctgtgcattttgagatcacaaaagatctttcttacttagac
caaggtcatcgggagggacagaggaagtctatgtcttctagcccctggatgcctcaggat
ggatttgatccttctgactacgcagagcccatggatgctgtggtcaagccaaggaatgag
gaagaaaacatatactcagtgccccacgacagcacccagggcaagatcattaccattcgg
aacatcaacaaagcccagtccaatggcagtggcaatggttctgacagtgagatggacaca
agctctctagagcgaggccgcaaagtatctgcagtgagtaagcctgtgctgtacaggacg
agatgcacccgcctggggcggtttgctagttaccgcaccagcttcagtgttgggagtgat
gatgagctgggacccatccgaaagaaagaggaggaccaggcatcccaaggttataaaggg
gacaatgctgtcattccttatgaaacagatgaggaccccaggaggaggaatatccttcga
agtctaaggaggaacaccaagaaaccaaagcccaaaccccgaccatccatcacaaaggca
acctgggagagtaactattttggggtgcctttaacaacagtggtgactccagagaagccg
atacccattttcattgaaagatgcattgagtacattgaagccacaggactaagcacagaa
ggcatctaccgggtcagcggaaacaagtcagaaatggaaagtttgcaaagacagtttgat
caagatcacaatctggacctggcagagaaagacttcactgtgaacactgtggcaggggcc
atgaagagttttttctcggagctaccagaccccctggtaccatacagcatgcagattgac
ttggtggaagctcacaagatcaacgacagggagcagaagctgcatgctctgaaggaagtg
ctgaagaagttccctaaggagaaccatgaagtcttcaaatatgtcatctcccacctgaac
agagtcagccacaacaacaaggtgaatcttatgaccagtgagaacctgtccatctgcttc
tggcccacgttgatgcggcctgacttcagcagcatggacgcactcacagccactcgatcc
taccagaccatcatcgagctcttcatccagcagtgccccttcttcttctacaaccggccg
atcagtgagccaccgggggctgcgcctggctccccttcagccatggcacccactgtcccc
ttcctcacctctacacctgctaccagtcagccatcacctccccagtcacctcctccaacc
cctcagtccccaatgcagccattgctctcctctcagctccaagccgaacacacgctgtga

DBGET integrated database retrieval system