KEGG   Rattus norvegicus (rat): 299027Help
Entry
299027            CDS       T01003                                 

Gene name
Eif2s3, Eif2g, Eif2s3x, PP42
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit gamma
  KO
K03242  translation initiation factor 2 subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    299027 (Eif2s3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    299027 (Eif2s3)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    299027 (Eif2s3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2_C GTP_EFTU GTP_EFTU_D2 RsgA_GTPase MMR_HSR1 MMR_HSR1_Xtn G-alpha Dynamin_N
Motif
Other DBs
NCBI-GeneID: 299027
NCBI-ProteinID: NP_001094012
RGD: 1561279
Ensembl: ENSRNOG00000060793
Vega: OTTRNOG00000000353
UniProt: P81795
Position
Xq22
AA seq 472 aa AA seqDB search
MAGGEAGVTLGQPHLSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggctgggggtgaggctggagtgactctcggacagccacatctttcccgacaggatctc
gccacattggatgttaccaagttgacaccactttcccatgaggttatcagcagacaagct
acaattaatattggtacaattggtcatgtagctcatgggaagtccaccgtggtaaaggct
atttctggagttcacactgtcagattcaaaaatgagctagaaagaaacattaccatcaag
cttggatatgctaatgctaagatttataaacttgatgacccaagttgtcctagaccagaa
tgttatagatcatgtggaagcagtacaccagatgagtttcctacagacattccagggacc
aaagggaacttcaaattagtcaggcatgtgtccttcgttgactgtcctggccatgatatt
ttgatggctacgatgctgaacggtgcagcggtgatggacgcagctcttctattgatagct
ggtaatgaatcgtgtcctcagccccagacttcagaacacctggctgccatagaaatcatg
aaactcaagcatattttgatcttacagaataaaattgatctggtaaaagaaagtcaggct
aaggaacaatatgagcaaattctcgcatttgtgcaaggaaccgtagcagaaggggcacca
attattccaatttctgctcagctgaaatacaatattgaagttgtctgtgaatacatagta
aagaaaataccagtgcccccaagagactttacttcagagccacgtcttattgttatcagg
tcatttgatgtcaacaaacctggctgtgaagttgatgaccttaagggaggtgtagctggc
ggtagtattctaaaaggagtgttaaaggtaggccaggagatagaagtcagacccggtatt
gtctccaaagacagtgaaggaaaactcatgtgtaaacccatcttttccaaaattgtgtca
cttttcgctgaacataatgatcttcagtatgctgccccgggtggtctcattggagttgga
acaaagatcgaccccactttgtgcagagctgacagaatggtgggacaagtgcttggtgca
gttggagctttacctgaaatattcacagaactggaaatttcctatttcctgctcagacgt
cttctgggcgtacgtactgaaggagacaagaaagcagcaaaggtccaaaaactgtctaag
aatgaagtgctcatggtcaacataggatccttgtcaacaggaggaagagttagtgctgtc
aaggctgatttgggcaagattgttttgaccaatcctgtgtgcacagaagtaggagaaaaa
attgcccttagcagaagagttgaaaaacactggcgtttaattggttggggtcagataaga
agaggagtgaccattaagccgactgtagatgatgactga

DBGET integrated database retrieval system