KEGG   Rattus norvegicus (rat): 299053
Entry
299053            CDS       T01003                                 

Gene name
Brms1l
Definition
(RefSeq) breast cancer metastasis-suppressor 1-like
  KO
K19196  breast cancer metastasis-suppressor 1 and related proteins
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299053 (Brms1l)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     299053 (Brms1l)
SSDB
Motif
Pfam: Sds3 Borrelia_P83
Other DBs
NCBI-GeneID: 299053
NCBI-ProteinID: NP_001100201
RGD: 1306006
Ensembl: ENSRNOG00000008249 ENSRNOG00000051077
Vega: OTTRNOG00000000783 OTTRNOG00000000784
UniProt: D3Z9D3
Position
6q23
AA seq 245 aa
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRME
CLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVA
GIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSE
LWNDELQSRKKRKDPFSPDKKKPVVVSDILSHTLWIFTLCSALKIAVSSVGGGHAAAHDA
AAVHI
NT seq 738 nt   +upstreamnt  +downstreamnt
atgccggtccattcccgaggagataagaaggagacgaatcatcacgatgagatggaggtg
gactacgcggagaacgaggggagcagttccgaagacgaggacaccgagagctcgtcggtc
tccgaggatggggacagctcagaaatggatgatgaagattgtgagaggagaaggatggaa
tgtttagatgagatgtccaaccttgagaagcagttcacagatctcaaagatcaactttat
aaagagcggttgagtcaggtggatgcaaaactccaagaagtcatagctggaaaagcacca
gagtatttggaaccactggcaactttacaagagaacatgcagattcgcacaaaggtagca
ggaatctatagagaactctgcttagagtctgtgaagaataagtacgaatgtgaaatccag
gcttctcgacagcattgtgagagtgaaaagcttttgttatatgatacagtccagagtgag
cttgaggagaagataagaaggcttgaggaggacaggcacagcatcgacattacctcagaa
ctgtggaacgatgagcttcagtcaaggaaaaagaggaaggatcctttcagccccgacaag
aagaagccagtcgttgtctcagatatcctttcccacactctctggattttcacactgtgc
tcagctttgaaaattgctgtgtccagtgtaggcggagggcacgcagcagctcatgatgca
gcagcggtccatatatag

DBGET integrated database retrieval system