KEGG   Rattus norvegicus (rat): 299104Help
Entry
299104            CDS       T01003                                 

Gene name
Fkbp3
Definition
(RefSeq) FK506 binding protein 3
  KO
K09570  FK506-binding protein 3 [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    299104 (Fkbp3)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     299104 (Fkbp3)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    299104 (Fkbp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTHB FKBP_C
Motif
Other DBs
NCBI-GeneID: 299104
NCBI-ProteinID: NP_001100206
RGD: 1304992
Ensembl: ENSRNOG00000004629
Vega: OTTRNOG00000001322
UniProt: G3V6L9
Position
6q24
AA seq 224 aa AA seqDB search
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFESKRFKGTETISKVSEQVKNVKLNDDKQKDSKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLPDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVELVDID
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgttccgcagcgtgcatggaccgtggagcagctgcgcagcgagcagctg
cccaagaaggacattatcaagtttctgcaggatcacggttcagattcgtttcttgcagaa
cataaattactgggaaacataaagaacgtagctaaaactgctaataaggaccatttggtt
actgcctacaaccatctttttgaaagtaagcgtttcaagggtactgaaactataagtaaa
gtatctgaacaggtgaaaaacgtgaagcttaatgatgataaacagaaagattccaagtct
gaagagacccttgatgagggtccacccaaatatacaaaatccgttctaaaaaagggagat
aaaaccaactttcctaaaaagggagatgttgttcactgctggtatacaggaacactccca
gatggaactgtttttgatactaacattcaaacaagttcaaagaagaagaaaaatgccaag
cctttaagttttaaggttggagtaggcaaggttatcagaggatgggatgaagcactctta
actatgagcaaaggagaaaaggctcgactggagattgaaccagaatgggcctatggaaag
aaaggacagccggacgccaaaattccaccaaataccaagctcatttttgaagtagaatta
gtagatattgactga

DBGET integrated database retrieval system