KEGG   Rattus norvegicus (rat): 299113Help
Entry
299113            CDS       T01003                                 

Gene name
Klhdc2
Definition
(RefSeq) kelch domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_4 Kelch_5 Kelch_1 Kelch_3 Kelch_6 Kelch_2
Motif
Other DBs
NCBI-GeneID: 299113
NCBI-ProteinID: NP_001029305
RGD: 1306504
Ensembl: ENSRNOG00000004474
UniProt: Q3KRE6
Position
6q24
AA seq 406 aa AA seqDB search
MADGNEDARAEDMPGPAFEGYEAMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYD
FYLPREELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHHSRGNTNKFYM
LDSRSADRVLQWERIDCQGIPPSSKDKLGVWVYKNKLIFFGGYGYLPEDKVLGTFEFDET
SFWNSSHPRGWNDHVHILDTETFAWSQPITTGKAPSPRAAHACATVGNKGFVFGGRYRDA
RMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTPVSSDHLFLFGGFTTEKQPLSDAWTY
CISKNEWIQFNHPYVEKPRLWHTACASDEGEVIVFGGCANNLLVHHRAAHSNEVLIFSVQ
PKSLVRLSLEAVICFKEMLANSWSCLPKHLLHSVNQRFGSNNTSGS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggcaacgaggatgctcgagcggaggacatgccaggcccggccttcgaaggc
tacgaggccatggagctggcctgcccggccgagcgcagcggccacgtcgccgtcagcgat
gggcgccacatgttcgtctggggcggctacaagagtaatcaagtgagaggactctatgac
ttctatctgcccagagaagaactgtggatctacaatatggagactggaagatggaagaag
atcaacactgaaggtgatgtgcccccgtccatgtctgggagctgtgctgtgtgcgtagac
agggtgctgtacttgtttggaggccaccattccagaggcaacacaaacaagttctacatg
ctggattcaaggtctgcagacagagtgttacagtgggaaaggattgattgccaaggaatt
cctccatcatcaaaggacaaacttggtgtctgggtatataaaaacaagttaatatttttt
ggaggctatggatatttacctgaagataaagtattgggaacatttgaatttgatgaaaca
tctttttggaattcaagtcatccaagaggatggaatgatcatgtccatattttagacact
gaaacatttgcctggagccagcccatcaccactggcaaggcaccttcacctcgtgctgcc
catgcctgtgcaactgttggaaacaagggttttgtatttggtggcagataccgagatgct
agaatgaatgatctgcactatcttaatctggacacatgggagtggaatgaactaattcca
caaggtatatgccctgttggccgctcctggcactcactgacaccagtttcttcagaccat
ctttttctcttcggaggatttaccactgaaaagcagccactaagtgatgcctggacttac
tgcatcagtaaaaatgaatggattcagtttaatcatccttatgttgaaaaaccaagattg
tggcatacagcttgtgcgagcgatgagggagaagtaattgtttttggtggttgtgccaac
aatctgctggtccatcatagagctgcacacagtaacgaagtacttatattttcagtccaa
ccaaaatctcttgtacggctaagcttagaagcagtcatttgctttaaagaaatgctagcc
aactcgtggagctgccttccaaaacacttacttcacagtgttaatcagaggtttggtagt
aacaacacttctggatcataa

DBGET integrated database retrieval system