KEGG   Rattus norvegicus (rat): 299154Help
Entry
299154            CDS       T01003                                 

Gene name
Churc1
Definition
(RefSeq) churchill domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Churchill zf-RRPl_C4
Motif
Other DBs
NCBI-GeneID: 299154
NCBI-ProteinID: NP_001100211
RGD: 1305116
Ensembl: ENSRNOG00000007336
UniProt: B5DER2
Position
6q24
AA seq 112 aa AA seqDB search
MCGDCVEKKYPNRGNTCLENGSFLLNFAGCAVCSKRDFMLITNRSLKEEDGEEIVTYDHL
CKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMALLF
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggggactgtgtggagaagaagtaccccaatcgggggaacacctgtctggagaat
ggctcgttcttactgaactttgcaggctgcgccgtgtgcagtaagcgggactttatgctg
atcacaaacagatccctgaaagaggaagatggagaagaaatagttacctatgaccatttg
tgtaagaattgtcatcatgtcatagccagacatgagtatacattcagcatcatggatgaa
tttcaggaatataccatgctgtgtctgttgtgtggcaaagccgaagatactatcagtatt
ctccctgatgacccccgacaaatggctctgttattctaa

DBGET integrated database retrieval system