KEGG   Rattus norvegicus (rat): 299156Help
Entry
299156            CDS       T01003                                 

Gene name
Rab15
Definition
(RefSeq) RAB15, member RAS oncogene family
  KO
K07908  Ras-related protein Rab-15
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    299156 (Rab15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    299156 (Rab15)
   04031 GTP-binding proteins [BR:rno04031]
    299156 (Rab15)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    299156 (Rab15)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   299156 (Rab15)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab15
    299156 (Rab15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA SRPRB GTP_EFTU FeoB_N RsgA_GTPase Septin PduV-EutP AAA_22 NACHT AAA_7 ABC_tran AAA
Motif
Other DBs
NCBI-GeneID: 299156
NCBI-ProteinID: NP_942044
RGD: 735172
Ensembl: ENSRNOG00000007364
UniProt: P35289
Position
6q24
AA seq 212 aa AA seqDB search
MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQ
IWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIG
NKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGL
RTCASNELALAELEEDEGKTEGPANSSKTCWC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacagtacgatgtgctatttcggctactgctgatcggggactccggggtgggc
aagacctgcctgctatgccgcttcaccgacaacgagttccactcctcgcatatctccacc
atcggtgttgactttaagatgaaaaccatcgaagtagacggcatcaaagtgaggatacag
atttgggacacagcagggcaggagaggtaccagactatcacaaaacagtactaccggcga
gcccagggaatatttttagtctacgacattagcagcgagcgctcttatcagcacatcatg
aagtgggtcagtgacgtggatgagtacgccccagaaggcgtccagaagatcctcatcggg
aataaggctgacgaagaacagaaacggcaggtggggagagagcaagggcagcagctggct
aaggagtatggcatggacttttacgaaacaagtgcctgcaccaaccttaacattaaagag
tccttcactcgtctgaccgagctggtgctgcaggctcacaggaaagagctggatggtctc
cgaacatgtgccagcaatgagctcgcactggccgagctggaggaagacgaaggcaaaact
gaaggcccagcaaactcttcaaagacctgctggtgctga

DBGET integrated database retrieval system