KEGG   Rattus norvegicus (rat): 299180
Entry
299180            CDS       T01003                                 

Gene name
Med6
Definition
(RefSeq) mediator complex subunit 6
  KO
K15128  mediator of RNA polymerase II transcription subunit 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    299180 (Med6)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     299180 (Med6)
SSDB
Motif
Pfam: Med6 Peptidase_M15 SAM_decarbox
Other DBs
NCBI-GeneID: 299180
NCBI-ProteinID: NP_001100212
RGD: 1310296
Ensembl: ENSRNOG00000006976
UniProt: B0BNE1
Position
6q24
AA seq 246 aa
MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHL
NQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVL
TAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVKPKAKRKEEPSSIFQRQRVDAL
LIDLRQKFPPRFVQQKSGEKPVPVDQAKKEAEPLPETVKSEEKESAKSAQQTVSTKGPPE
KRMRLQ
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcggcggtggatatccgagataatctgctgggaatctcttgggttgacagttcttgg
atccccattttgaacagtggtagtgtcctggattacttttcagaaagaagcaatcctttt
tatgacaggacgtgtaataatgaagtggttaaaatgcagaggctgacattagagcacttg
aatcagatggttggaatcgaatacatccttttacatgctcaagagcccattcttttcatc
attcgaaagcaacagcggcagtcccccgctcaagttattccactggctgattactatatc
atcgctggagtcatctatcaggcgccagacttgggatcagttataaactccagagtgctt
accgcagtgcatggcattcagtcagcttttgatgaagctatgtcatactgtcgatatcat
ccttccaaagggtattggtggcactttaaagatcatgaagagcaagataaagtcaaacct
aaagccaaaaggaaagaagaaccaagctctattttccagagacaacgtgtggatgcttta
ctcatagacctcagacagaaatttccacccagatttgttcagcaaaagtctggagagaag
cctgtcccagtggaccaggcaaagaaagaggcagagcccctgccagaaactgtaaagtcc
gaggagaaggagagcgcaaagagcgctcagcagactgtaagcactaaaggtccccctgag
aagcgaatgagacttcagtga

DBGET integrated database retrieval system