KEGG   Rattus norvegicus (rat): 299210Help
Entry
299210            CDS       T01003                                 

Gene name
Esrrb, Err2, Errb
Definition
(RefSeq) estrogen-related receptor beta
  KO
K08553  estrogen-related receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    299210 (Esrrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    299210 (Esrrb)
   03029 Mitochondrial biogenesis [BR:rno03029]
    299210 (Esrrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    299210 (Esrrb)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    299210 (Esrrb)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    299210 (Esrrb)
Nuclear receptors [BR:rno03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   299210 (Esrrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 299210
NCBI-ProteinID: NP_001008516
RGD: 1359557
Ensembl: ENSRNOG00000010259
UniProt: P11475
Position
6q31
AA seq 433 aa AA seqDB search
MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGMALGTHANGLDSPP
MFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASC
EACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRG
GRQKYKRRLDSENSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPDDVPEGDIKAL
TTLCDLADRELVFLISWAKHIPGFSNLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLA
YAEDYIMDEEHSRLVGLLELYRAILQLVRRYKKLKVEKEEFVMLKALALANSDSMYIENL
EAVQKLQDLLHEALQDYELSQRHEEPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgaagacaggcacctgggctctagctgcggctccttcatcaagacggagcca
tctagcccatcctcgggcattgatgccctcagccaccacagccccagcggctcgtcggac
gccagcggtggctttggcatggccctgggcacccacgccaacggtctggactctccgcct
atgttcgcaggtgcggggctgggaggcaacccgtgtcgcaagagctacgaggactgtact
agcggtatcatggaggactcggccatcaagtgcgagtacatgcttaacgccatccccaag
cgcctgtgcctcgtgtgcggggacattgcttctggctaccactatggagtggcctcctgc
gaggcttgcaaggcgttcttcaagagaaccattcaaggaaacatcgaatacagctgccct
gccaccaacgagtgtgagatcaccaaacggaggcgcaagtcctgtcaggcctgccggttc
atgaaatgcctcaaagtggggatgctgaaggaaggcgtgcgccttgaccgggtgcgagga
ggccgccagaagtacaagagacggctggattcggagaacagcccctacctgagcttacag
atttccccgcctgctaaaaagccattgactaagattgtctcgtatctactggtggccgag
ccggacaagctgtacgctatgcctcccgacgatgtgcctgaaggggatatcaaggccctg
accactctctgtgacttggcagatcgggagcttgtgttcctcattagctgggccaagcac
atcccaggtttctccaacctgacactcggggaccagatgagcctgctgcagagtgcctgg
atggagatcctcatcctgggcatcgtgtaccgctcgcttccctatgatgacaagctggca
tacgcggaggactatatcatggatgaggaacactctcgcctggtggggctgctggagctt
taccgagccatcttgcagctcgtacgcaggtacaagaagctcaaggtggagaaggaagag
tttgtgatgctcaaagccctggcccttgccaactcagattcaatgtacatcgagaacctg
gaggctgtgcagaagcttcaggacctgctgcatgaggcgctgcaggactatgagctgagc
cagcgccatgaggagccacggagggcgggcaagctgctgttgacactgcccctgctgcgg
cagacggcagccaaagccgtccagcacttctacagtgtgaaactgcagggcaaggtgccc
atgcacaaactcttcctggagatgctggaggccaaggtgtga

DBGET integrated database retrieval system