KEGG   Rattus norvegicus (rat): 299236Help
Entry
299236            CDS       T01003                                 

Gene name
Flrt2
Definition
(RefSeq) fibronectin leucine rich transmembrane protein 2
  KO
K16362  leucine-rich repeat transmembrane protein FLRT
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    299236 (Flrt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 fn3 LRRNT LRRCT LRR_1 Syndecan
Motif
Other DBs
NCBI-GeneID: 299236
NCBI-ProteinID: NP_001100220
RGD: 1308574
Ensembl: ENSRNOG00000003732
UniProt: D3ZTV3
Position
6q31
AA seq 660 aa AA seqDB search
MGLQTAKWPSHGTFVLKFWLIMSLGLYSHVSKLLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIADGTFSHLTKLKEFSIVRN
SLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFANLRKLERLDISNNQLRMLTQGVFDHLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPVFTPAPSTVSPTTQSPTVSVPSPSRGSVPPAPAPSKLPTIPDWDGRERATPP
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRTVEDTICSEATTHASYLNNGSNTASSHEQTTSHTMGSP
FLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgcagactgcaaagtggcccagccatgggacttttgttctaaaattttggctc
atcatgtccctgggactgtactcacatgtgtcaaaactcctggcctgccctagtgtgtgt
cgatgtgacaggaactttgtctactgtaatgagagaagcttgacctcagtgcctcttggg
atcccggagggcgtaaccgtactctacctccacaacaaccaaattaataatgctggattt
cctgcagagctgcacaacgtacagtcagtgcacacggtctacctttacggcaaccaactg
gatgaattccccatgaacctccccaagaatgtcagagttctccatctgcaggaaaacaac
attcagaccatctcgcgggctgctcttgctcagctcctcaagctggaagaactacaccta
gatgacaactccatatctacagtgggagtggaagacggggccttccgggaggcaataagc
ctcaaactgttgtttttatcaaagaatcacctgagtagcgtgcctgttgggctccccgta
gacttgcaagagctgagagtggatgaaaaccgaatcgcggtcatttcagacatggccttt
cagaacctcacaagcttggagcgtctgatcgtggatgggaatcttctgaccaacaagggc
attgctgacggtaccttcagccatctcaccaagctcaaggaattttccatagtccggaac
tcgctctcccacccgcctcccgacctcccaggtacgcatctgatcaggctctacttacag
gataaccagataaaccatatcccattgacagccttcgcaaacctccgtaagctggaaagg
ctcgatatatccaataaccagctacgaatgttaactcaaggagtcttcgatcatctctcc
aacctgaaacaactcaccgctcggaataacccttggttttgcgactgcagcatcaaatgg
gtcaccgaatggctcaaatatatcccttcttctctcaatgtgcgtggtttcatgtgccaa
ggtcccgagcaagtccgggggatggctgtcagggagttgaatatgaatctcttgtcttgt
cccaccacgactcccggcctacctgtctttaccccagctcccagtacagtgtctccaaca
actcagtctcccactgtctctgttccaagccccagcagaggctcggtgcctccagctccc
gccccatccaaacttcccaccatcccggactgggatggcagagaaagagcgaccccacct
atttctgaaaggatccaactttccatccacttcgttaatgatacttcaattcaagtcagc
tggctgtctctctttacggtgatggcctacaaactgacgtgggtgaaaatgggccacagt
ctcgtagggggaatcgttcaggaacgcattgtcagcggtgagaagcagcacctgagcttg
gttaatttagagcccagatccacgtacaggatttgtttagtgccactggacgcgttcaac
taccgcactgtggaagataccatctgttctgaggccaccacccacgcctcttatttgaac
aatggcagcaacactgcgtctagccatgagcaaacaacttcccacaccatggggtcccct
tttctgctcgcgggcttgatcgggggtgcggtgatttttgtgctcgtggtcttgctcagt
gtcttttgctggcacatgcacaaaaagggacgctacacctcccagaagtggaaatacaac
cggggccgacggaaagatgactattgtgaggcaggtaccaaaaaggacaactccatcttg
gagatgacagaaacaagttttcagattgtctctttaaataacgatcagctccttaaagga
gatttcagactgcagcccatttataccccaaatgggggcattaattacacagactgccac
atccccaacaacatgagatactgcaacagcagtgtgccagatctggagcattgtcacacg
taa

DBGET integrated database retrieval system