KEGG   Rattus norvegicus (rat): 299258Help
Entry
299258            CDS       T01003                                 

Gene name
Golga5, Ret-II
Definition
(RefSeq) golgin A5
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Golgin_A5 Spc7 DivIC PKcGMP_CC TPR_MLP1_2
Motif
Other DBs
NCBI-GeneID: 299258
NCBI-ProteinID: NP_001028237
RGD: 1308163
Ensembl: ENSRNOG00000007699
UniProt: Q3ZU82
Position
6q32
AA seq 728 aa AA seqDB search
MSWFADLAGRAEDLLNRVDQGAATALRKESTSNTFYSKNTDYPELHQQNTDSTYHTGQKA
NYISSAADNIRHQKATIIAGTANVKVGSRTGGDASHPTEHASVPRPSSHFVRRKKSEPDD
ELLFDFLNSSQKEPTGRVEIKKEKGKAPVLPSSQSSAVSSVTTSVTTIKATEENSGSQSP
EVSSSDSMPEGHKKSTEESTVSNAISVEHSSVPSDGSMSHELSNLRLENQLLRNEVQSLN
QEMASLLQRSKETQEELNEARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLA
VLKVRLQEADQVLSSRTEALEALQSEKSRIMQDHNEGSSLQNQALQTLQERHEADATLKR
EQESYKQMQSEFATRLNKMEVERQNLAEAVTLAERKYSEERKKVDDLQQQVKLHRSSLES
AKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLDSSTASSMELEELRHERELQKEEIQ
KLMGQIHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRASKQELETELDRMKQEFH
YVEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQSELESRLHQLTETLIQKQT
LLESLSTEKNSLVFQLERLEQQLHSAATGPSSGSSINMSGVDSGEGTRLRNVPVLFNDTE
TNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYSPEM
HHDQPYGK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtttgctgatcttgctggaagggctgaagatcttttaaaccgagtggatcag
ggggctgcaacagctctcagaaaggagagtaccagcaacaccttttatagcaaaaatact
gactatcctgaacttcaccagcaaaacacagattcaacttaccacactggacagaaagct
aactatatttcctcagctgctgataacatccggcatcagaaagccacgatcatagctggc
acagcaaatgtgaaagtcggatccaggacaggcggagatgcctcccatcccactgaacat
gcatctgtccctaggccttcatcccattttgttcggaggaaaaagtcagagcctgatgat
gagctgctattcgattttcttaacagttcccagaaagagcccactgggagagtggaaatc
aagaaagagaagggcaaagcacctgtgctcccaagttctcagtcatcagctgtcagttct
gtcaccaccagtgtaaccaccatcaaggccactgaagaaaattctgggagccaaagtcct
gaagtgagtagctctgattctatgccggaaggtcataaaaaatccacagaggaaagcaca
gtatcgaatgctatcagtgtggagcacagctctgtacctagtgatggaagcatgtcccat
gagctgtctaatctccgactggagaatcagctgctcaggaatgaagtccagtctttaaat
caggaaatggcctcattgcttcagagatccaaggaaactcaagaagaattaaacgaggca
agagtaagagttgaaaaatggaatgttgacaattcaaagagtgatcgaataactcgggaa
ctacgagcccaagtcgatgatctcactgaagcagtggctgcaaaggactcccagctggct
gtcctcaaagtgcgactgcaggaggctgaccaggtgctgagctcccgcacggaagcactg
gaagctttacagagtgaaaagtcacgaataatgcaggatcacaatgaaggtagtagtcta
caaaatcaagctctgcaaactcttcaggagaggcatgaagcggatgccactctgaagaga
gagcaagagagctacaaacaaatgcagagtgagtttgctacacgccttaataaaatggaa
gtggaacgtcagaatttggcagaagcagttaccctggcagaaagaaagtactctgaggag
aggaagaaggttgatgacctccagcagcaagtcaagttacacaggtcgagcttggagtcc
gctaagcaggagttagttgactacaagcaaaaagctacaaggatactccaatctaaagaa
aaactgatcaatagcttaaaggaaggctcgagttttgaaggcctagatagcagtactgct
agcagcatggaactagaagaacttcggcatgagagagagttgcagaaggaggagatccag
aagttgatgggccagatacatcagctgagatctgagctacaggatatggaggctcagcag
gttagtgaagcagaatcagcaagagaacaattacaagatctgcaagaccagatagctaag
cagagggcatctaaacaagagctggaaacggagctggaccgaatgaaacaggaattccat
tacgtggaggaagatctgcatagaacgaagaacacactgcaaagcaggattaaagatcga
gaggaggaaattcaaaagctgaggaatcagctcaccaacaaaactttaagcaacagcagc
cagtcggagctagagagccgcctccatcagctaacggaaacactcatccagaagcagacc
ctgctggagagcctcagcacagagaagaactccctggtcttccagctggagcgcctcgag
cagcagctgcactctgccgccacggggcccagcagcggatcctccattaacatgtctgga
gttgacagtggtgaagggacacgcctgcgaaatgttcctgttctttttaatgacacagaa
actaatctagcaggaatgtatgggaaggttcgcaaagctgctagctccattgaccaattt
agtattcgcctgggaattttcctccggaggtaccccatagcacgagtgtttgtgattatc
tatatggctttacttcacctctgggtcatgattgtcctgctgacctactcaccagaaatg
caccatgaccaaccgtacggcaagtga

DBGET integrated database retrieval system