KEGG   Rattus norvegicus (rat): 299276Help
Entry
299276            CDS       T01003                                 

Gene name
Serpina3m, SPI-2.4
Definition
(RefSeq) serine (or cysteine) proteinase inhibitor, clade A, member 3M
  KO
K04525  serpin A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    299276 (Serpina3m)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   299276 (Serpina3m)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 299276
NCBI-ProteinID: NP_001257911
RGD: 735068
Ensembl: ENSRNOG00000009921
UniProt: F1LR92
Position
6q32
AA seq 419 aa AA seqDB search
MAFIAALGLLMAGICPAVLGFPDGTLGNDTLLHKDQDKGTQLDSLTLESINTDFAFSLYK
MLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESYETDIHQGFGHL
LQRLSQPGDQVKIITGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRVTEKLIND
YVRNQTQGKIQELVSGLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVKVS
MMKIEELTTPYFRDEELSCSVLELKYTGNSSALFILPDKGRMQQVEASLQPETLKKWKDS
LRPRKIDELYLPRLSISTDYSLEEVLPELGIRDVFSQQADLSRITGAKDLSVSQVVHKVV
LDVNETGTEAAAATGANLVPRSGRPPMIVWFNRPFLIAVSHTHGQTILFMAKVINPVGA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccttcattgcagctttggggctcctgatggctgggatctgccctgctgtccttggc
ttcccagatggcacactgggaaatgacactctactccataaagatcaagacaaggggaca
caactggacagtctcacattggagtccatcaacactgactttgccttcagcctttacaag
atgctggctttgaagaatccagataaaaatgttgtcttctccccacttagcatctcagct
gccttggccattgtgtccctgggagcaaagggcaacaccctggaagagattctagaagtt
ctcaggttcaatctcacagagagctatgagacagacatccaccagggctttgggcacctc
ctccagaggctcagtcagccaggggaccaggtaaagatcatcacaggcaatgctctgttt
attgataagaaccttcaggtcctggcagagttccaggagaagacaagggctctgtaccag
gttgaggccttcacagctgacttccagcagcctcgtgtgaccgaaaagctcatcaatgac
tatgtgagaaatcagacccaggggaagatccaggaactggtctcaggcctgaaagagagg
acatccatggtgctggtgaactacctcctctttagaggcaaatggaaggtgccctttgac
cctgattacacatttgagtctgagttctacgtggatgagaagaggtctgtgaaggtgtcc
atgatgaaaattgaggaactgactacaccttacttccgggatgaggagctgtcctgctct
gtgctggaactgaagtacacaggaaattccagtgccctgttcatcctccctgataagggc
aggatgcagcaagtggaagccagcttgcaaccagagaccctgaagaagtggaaggactct
ctgaggcccaggaagatagatgagctctacctgcccaggttatccatttccactgactat
agcctggaggaggtccttccagagctgggcattagggatgtcttctcccagcaagctgat
ctgagtaggatcacaggggccaaggacctgagtgtctctcaggtggtccacaaggttgtg
ctggatgtgaatgagacaggcacagaagcagctgctgccacaggagccaatttggtccca
cgtagtggaaggccacctatgattgtgtggttcaacaggccattcctgatagctgtctct
cacacacatggtcagactatcctctttatggccaaagtcattaaccccgtgggagcctaa

DBGET integrated database retrieval system