KEGG   Rattus norvegicus (rat): 299284Help
Entry
299284            CDS       T01003                                 

Gene name
Dicer1
Definition
(RefSeq) dicer 1 ribonuclease III
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    299284 (Dicer1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299284 (Dicer1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     299284 (Dicer1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    299284 (Dicer1)
   microRNA pathway
    RISC loading complex
     299284 (Dicer1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 PAZ Ribonucleas_3_3 Dicer_dimer Helicase_C ResIII DEAD dsrm
Motif
Other DBs
NCBI-GeneID: 299284
NCBI-ProteinID: XP_008763126
RGD: 1309381
Ensembl: ENSRNOG00000010711
UniProt: E9PU15
Position
6q32
AA seq 1918 aa AA seqDB search
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELAHQIRGDLSPHAKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVNASWTKERWSQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCDSCPSCPRILGLTASILNGKCDPDELEEKIQKLEKILKSGAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALDFINDCNVSVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTLLRKIHALCE
EYFSPASLDLKYVTPKVMKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDD
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRSKQMEAEFRKQEEVLRKFRAHETNLLIATSVVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDGAEAD
VHAVVDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD
GTFYSTLYLPINSPLRASIVGPPMGCVRLAERVVALICCEKLHKIGELDEHLMPVGKETV
KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPKPDQPCYLYVIGMVLTTP
LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSQ
QMLELVTRLHQYIFSHILRLEKPALEFQPAGAESAYCVLPLNVVNDSSTLDIDFKFMEDI
EKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF
PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR
KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGV
GVRSLPADFRYPNLDFGWKKSIDSKSFISTCNSSLAESDNYCKHSTTVVPENAAHQGATR
PSLENHDQMSVNCKRLPAESPAKLQSEVSVDLTAINGLSYNKSLANGSYDLVNRDFCQGN
QLTYFKQEIPVQPTTSYPIQNLYNYENQPTPSNECPLLSNKYLDGNANTSTSDGSPAGSP
RPAMMTAVEALEGRTDSEQSPSVGHSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKQGLPSRMVVSIFDPPVNW
LPPGYVVNQDKSNSEKWEKDEMTKDCLLANGKLGEDCEEEEEEELAWRAPKEEAEYEDDL
LEYDQEHIQFIDSMLMGSGAFVKKIPLSPFSTSDSAYEWKMPKKASLGSVPFSSDLEDFD
YSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIADC
VEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSRDKASYPAQENSSSQQKSPSGSCA
AAVSPRSSAGKDLEYGCLKIPPRCMFDHPDAEKTLNHLISGFENFEKKINYIFKNKAYLL
QAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTI
FASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEV
PKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPET
AKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPLVPNS
NT seq 5757 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccctgctttgcagcccctcagcatggcaggcctgcagctcatgacccctgct
tcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataac
atttatacgccaagaaaataccaggttgagctgctggaagcagctctggaccacaacacc
attgtgtgcttgaacactggctcagggaagacgttcatcgccgtcctgctcaccaaagag
ctggcccaccagatcaggggcgacctcagtccgcatgcaaaaaggactgtgttcctcgtc
aactctgcaaaccaggttgctcaacaagtgtcagctgtcagaactcactcagatctcaag
gttggggagtactcaaacctcgaagtgaatgcatcttggacaaaagagagatggagccaa
gagtttactaagcaccaggttctcattatgacttgctatgtcgccttgaatgttttgaaa
aatggttacttatcactgtcagacattaaccttttggtgtttgatgagtgtcatcttgca
attctagaccacccctatcgtgaaattatgaagctctgtgacagttgtccatcatgccct
cgaattttgggactaactgcttccattttaaatgggaaatgtgacccagacgaattggaa
gaaaagattcagaaactggaaaagattctcaagagtggcgctgagaccgcaactgacctg
gtggtcctggacagatacacttctcagccttgtgagattgtggtggattgcggaccattt
actgacagaagtgggctttatgaaagactgctgatggagttagaagaagcacttgacttt
atcaatgactgtaatgtatctgtacattcaaaggaaagagattctactttgatttccaaa
caaatcctctcagactgccgtgcagtgctggtcgtcctgggaccctggtgtgcagataaa
gtagcggggatgatggtaagagaacttcagaagtacatcaaacatgagcaagaggagcta
cacaggaagttcttattgtttacagacactctgctaaggaaaatacatgcactgtgtgaa
gagtacttctcccctgcctcacttgacctgaagtatgtaactcccaaagtcatgaaactg
ctcgagatcctgcgcaaatacaagccctatgagcgacagcagttcgaaagtgttgagtgg
tacaataacaggaatcaggataattatgtgtcctggagtgattctgaggacgatgacgat
gatgaagaaattgaagaaaaagaaaagccagagacaaattttccttctccatttaccaat
attttatgtggaattatttttgtggaaagaagatacacagcagttgtcctaaacagattg
ataaaggaagctggcaaacaagatccagagctggcttatatcagcagcaactttataact
gggcatggcattggaaagaaccagcctcgcagcaagcagatggaggcggagttcagaaag
caagaggaggtacttaggaaatttcgagcacatgagaccaacctgctcattgcaacaagt
gttgtagaagagggtgtggacattcccaagtgcaatttggtggttcgttttgatttgccc
acagagtatcgttcttacgttcagtctaaaggacgggcacgagcaccgatctctaattat
gtaatgttagcagacacagacaaaataaagagctttgaagaagacctcaagacctacaaa
gctatagaaaagatcttaagaaacaagtgttcaaagtcagtggatggtgctgaggctgac
gtccatgctgttgtagatgatgatgatgttttcccgccatatgtactgaggcctgatgat
gggggtcctcgagtcacaatcaacactgccattggacacatcaacagatattgtgctcga
ttaccaagtgatccgtttacgcatctagctcccaaatgtagaacccgagaattgcctgat
ggtacattttattcaactctttatcttccgattaactcacctcttcgagcctccattgtt
ggtccaccgatgggctgtgtacggctggctgagagagtggtagctctcatctgctgtgaa
aaactgcacaaaattggtgaactggatgaacatttgatgccagttgggaaagagactgtt
aagtatgaagaagaacttgacttacatgatgaagaggagaccagcgttccagggagacca
ggatccacaaaacgaaggcagtgctaccccaaagcaattccagagtgcttgagggagagt
taccccaaacccgatcaaccctgttacctgtatgtgataggaatggtcttaaccaccccc
cttcctgatgagctcaacttcaggcggcggaagctctaccctcctgaggacaccaccaga
tgctttgggatcctgacagccaaacccatacctcagatccctcactttcctgtgtatact
cgctctggagaggtcaccatatccatcgagctgaagaagtctggtttcacactgtctcaa
caaatgcttgagctggttacgagactgcaccagtacatattctcacacattctccggctc
gagaagcctgccctggagtttcaacccgcgggcgctgagtcagcgtactgtgttctacct
cttaacgtcgttaatgactccagcactttggacattgactttaaattcatggaggatatt
gagaagtctgaagctcgtataggcattcccagcactaagtattcaaaggaaacaccgttt
gtttttaagttagaagattaccaagatgcagttatcattccaagataccgcaattttgat
cagcctcatcgattttatgtagctgatgtgtatactgatcttaccccactcagtaaattt
ccttcccctgaatatgaaacttttgcagaatattataaaacaaagtataaccttgacctg
accaatctcaaccagccactgctggatgttgaccacacatcttccagactgaaccttcta
acccctcggcatttgaatcagaaggggaaagcacttcctctaagcagtgctgaaaagagg
aaagccaaatgggaaagtctgcagaacaaacagatactggttccggaactctgtgctata
catccaatcccagcatcactgtggagaaaagcagtttgtctccccagcatactgtatcgc
cttcactgccttctgactgcggaggagctcagagctcagacagccagcgatgctggcgta
ggagtcagatcacttccggccgattttagataccctaacttagacttcgggtggaaaaag
tctattgatagcaagtctttcatctcaacctgtaactcctcgttggctgagagtgataat
tactgtaagcacagcacaactgtagtccctgaaaatgctgcacatcaaggtgctactaga
ccctccttagaaaaccatgaccaaatgtctgtgaactgcaaaaggttgcccgccgagtca
cctgctaagctccaaagtgaggtttcagtggatcttacagcaatcaatggtctttcttac
aataaaagccttgccaatggcagttatgatttagttaacagagacttttgccaaggaaat
cagctgacttacttcaagcaggaaatacctgtacaaccaactacctcatatcccattcag
aatttatacaattatgagaaccagcccacgcccagcaatgaatgtcctctactgagtaat
aagtaccttgatgggaacgctaacacatctacctcagacggaagccccgcagggtcccca
aggcctgccatgatgactgctgttgaagcactggagggcaggacagactctgagcagagc
ccttctgtggggcactcctcaaggactctcggccccaacccaggactgattcttcaggct
ttgacactgtcgaacgctagcgatgggtttaacctagagcggcttgagatgcttggcgac
tccttcttaaagcacgctatcaccacgtatctgttttgcacataccctgatgctcatgag
ggccgcctttcatatatgagaagcaaaaaggtcagcaactgtaacctgtaccgccttggc
aagaagcagggactgcccagccgcatggtggtgtcgatatttgatcctcctgtgaattgg
cttcctcctggttatgtggtaaaccaagacaaaagtaactcagagaaatgggaaaaggat
gaaatgacaaaagactgcttgctggctaatggcaaactgggtgaggactgtgaggaggag
gaggaggaggagctggcgtggagggctcccaaggaggaggctgagtatgaagacgacctc
ctggagtatgaccaggagcacattcagtttatagacagcatgctaatgggctcaggggcc
tttgtgaagaaaatccctctttcccccttttccacctctgattctgcatatgaatggaaa
atgcccaaaaaggcctccctgggcagtgtgccgttttcctcagaccttgaggattttgat
tacagctcttgggatgcaatgtgctatctggatcctagcaaagccgttgaagaggatgac
tttgtggtaggtttctggaatccatcagaagaaaactgtggcgtggacacagggaagcag
tccatttcttacgacttgcacactgagcagtgcatcgcggacaagagcatagcggactgc
gtggaggccctgctgggctgttacttaaccagctgtggtgagagggctgctcagctcttc
ctctgctcgctggggctgaaggtgctcccagtcatcaaaaggaccagccgggacaaggcc
tcgtaccctgctcaggagaactcaagcagccaacagaagagcccttcagggagctgtgct
gctgcagtcagtccccgctcctctgcagggaaagacttggagtatggctgcttgaagatc
ccgccaaggtgtatgtttgaccatccagatgcagagaaaaccctgaaccacctcatatct
gggtttgaaaattttgaaaagaaaatcaactacatattcaagaataaggcttaccttctg
caggcttttacacatgcctcctaccactacaacactattactgattgttaccagcgctta
gaattcctgggagatgcgattttggactacctcataaccaagcacctttatgaagaccca
cggcagcattctccaggggtcctgactgacctgcgctctgccctggtcaataacaccatc
tttgcgtcgctggctgtgaagtatgactaccacaagtactttaaagccgtctctcctgag
ctcttccacgtcattgatgacttcgtgcagtttcagctggagaagaacgagatgcaagga
atggactctgagcttaggagatccgaggaggatgaggagaaagaagaggatattgaagtc
cccaaggccatgggagacatttttgagtctcttgctggtgccatttatatggacagtggg
atgtccctggaggtggtctggcaggtgtactatccgatgatgcggcctctaatagaaaag
ttttctgcaaatgtgcctcgttctccggtaagagaattgcttgagatggaaccagaaact
gccaagtttagcccagcggagagaacttacgatgggaaggtcagagtcaccgtggaagtg
gtgggaaaggggaagtttaaaggtgtcggccggagctacaggatcgcaaagtctgctgca
gcacgaagagccctccgcagcctcaaagctaaccagcctctggttcctaacagctga

DBGET integrated database retrieval system