KEGG   Rattus norvegicus (rat): 299310Help
Entry
299310            CDS       T01003                                 

Gene name
Ndufb11, RGD1563698
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B11
  KO
K11351  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    299310 (Ndufb11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    299310 (Ndufb11)
  09159 Environmental adaptation
   04714 Thermogenesis
    299310 (Ndufb11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    299310 (Ndufb11)
   05012 Parkinson disease
    299310 (Ndufb11)
   05016 Huntington disease
    299310 (Ndufb11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    299310 (Ndufb11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ESSS
Motif
Other DBs
NCBI-GeneID: 299310
NCBI-ProteinID: NP_001100226
RGD: 1563698
Ensembl: ENSRNOG00000008329
UniProt: D4A7L4
Position
Xq11
AA seq 151 aa AA seqDB search
MAARLLSLYARRLSVAAAIREVPAARVRWESSRAVIAPSGVERKRQREPTMVWQEDPEPE
DENLYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYLPDYRMQEWARREA
ERLVKYRELNGLPIMESNYFDPSKIQLPEDD
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccggctgttaagcttgtatgctcgccgcctgtcagtagcggcggcgatacga
gaggtcccggctgcccgtgttcgctgggaatcttccagggctgtaatcgccccgtccggt
gtggagagaaagcggcaaagagaaccgaccatggtatggcaggaggacccagaacccgag
gacgaaaacctctacgcgaagaacccagactttcacggttatgacagtgaccctgtggtg
gacgtctggaatatgcgagctgtcttcttctttggtttttccatcgtcctggtttttggt
accacctttgtggcttacctgcctgattacaggatgcaagagtgggcccgccgggaagct
gagagacttgtgaaataccgagaactcaacggcctccccatcatggaatccaactatttt
gatcccagcaagatccagttaccagaagatgactga

DBGET integrated database retrieval system