KEGG   Rattus norvegicus (rat): 299314Help
Entry
299314            CDS       T01003                                 

Gene name
Cfp, Pfc
Definition
(RefSeq) complement factor properdin
  KO
K15412  complement factor properdin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    299314 (Cfp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 TSR
Motif
Other DBs
NCBI-GeneID: 299314
NCBI-ProteinID: NP_001100227
RGD: 1594557
Ensembl: ENSRNOG00000025811
UniProt: B0BNN4
Position
Xq11
AA seq 465 aa AA seqDB search
MPVGMQAPQWLLLLLLILPTTGSDPVLCFTQYEEPSGRCKGLLGRDIRVEDCCLNTAYAF
QEHDGGLCQSCRSPQWSAWSSWGPCSVTCSEGSQLRHRRCVGRGGQCSEKAAPGTLEWQL
QACEDQLCCPEMGGWSEWGPWGPCSVTCSKGTQTRQRLCDNPAPKCGGHCPGEAQQSQAC
DTQKICPTHGAWASWGPWSACSGSCLGGAQEPKETRSRSCSAPAPSHQPPGKPCSGTAYE
HRGCSGLPPCPVAGGWGPWGPSSPCPVTCGLGQTLERRTCDHPVPRHGGPFCAGDATRKH
VCNTAMPCPVNGEWEAWGKWSHCSRVRMKSISCDEIPGQQSRSRSCGGRKFDGQPCTGKL
QDIRHCYDIHNCVLKGSWSQWSTWGLCTPPCGPNPTRVRQRLCTPLLPKYSPTVSMVEGQ
GEKNVTFWGIPRPLCEVLQGQKLVVEEKRPCLHVPSCRDPEEKKP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttggaatgcaagcccctcagtggctcctgctcctattgcttatcctgccaacc
acaggctcagaccctgtgctctgcttcacccagtatgaggagccctctggcaggtgcaaa
ggcctacttggaagagacatcagggtggaagattgctgtctcaacactgcctatgccttc
caggaacatgatgggggcctctgtcagtcatgcaggtccccacaatggtcagcatggtcc
tcatgggggccctgctcagttacatgctctgaggggtcccagctgcgacacaggcgctgt
gtgggtaggggtggacagtgctctgagaaggcggctcctggaactcttgagtggcagcta
caggcctgtgaggatcagctatgctgtccagagatgggtggctggtctgagtggggaccc
tgggggccttgctctgtcacctgctccaaaggaacccagacccgtcaacgactatgtgat
aatcctgctcctaagtgtggaggccattgccccggagaggcccagcaatcacaggcctgt
gacactcagaagatctgccccacacatggggcctgggcatcctggggcccctggagcgcc
tgctcaggatcatgccttggcggagctcaagaacctaaggagacacgaagccgctcatgt
tctgcaccagcaccttcacaccaaccccctgggaagccctgctcaggaacagcctatgag
catcggggctgtagtggcctaccaccttgcccagtggctggtggctggggaccatggggc
ccttcaagtccctgcccggtgacttgtggcctgggccagaccctagaacgacggacatgt
gatcaccctgtaccccgtcatgggggccccttttgtgctggtgatgccactcggaaacac
gtctgtaacacagccatgccttgccctgtaaatggagagtgggaggcctggggaaaatgg
agtcactgcagccgtgtgagaatgaagtccatcagctgtgatgaaatcccaggccagcag
tcacgttcaaggagctgtggtggccgcaaatttgatgggcagccatgtactgggaaactc
caagatattcgacactgctatgacatccataactgtgtcttgaaaggttcatggtcacag
tggagtacctggggtctgtgcacaccaccatgtggacccaaccccacccgtgtccgtcag
cgactctgcacacctttgctccccaagtactcgcctacagtttccatggttgaaggtcag
ggtgagaagaatgttaccttctgggggatcccacggccactgtgtgaggtgctacagggg
cagaagctggtggtggaagagaaacggccatgtctacatgtgccttcctgcagagatcca
gaagagaagaaaccctaa

DBGET integrated database retrieval system