KEGG   Rattus norvegicus (rat): 299339Help
Entry
299339            CDS       T01003                                 

Gene name
Tnfaip2
Definition
(RefSeq) TNF alpha induced protein 2
  KO
K19989  tumor necrosis factor alpha-induced protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    299339 (Tnfaip2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec6 CDC27
Motif
Other DBs
NCBI-GeneID: 299339
NCBI-ProteinID: NP_001131105
RGD: 1594556
Ensembl: ENSRNOG00000010165
UniProt: D3ZYQ3
Position
6q32
AA seq 691 aa AA seqDB search
MLKMVTFFQGLPGQQSVPGTLDLPGSPQKPRSTSEAESETSMSEASSEDLMPSQEAPEGE
EESAKKKEKKSKGLANMFSVFTKGKKKKKDQPRLSDPEVQSKSRPEEDGPLPTVEELKEA
LELGRLEVAWQVLALERQLEAAAAAGGTSDEELVWRQSKVEALYVLLRDQVLRVLRRPLE
AAPERLSQALAVVSQEELEDRRASRGPLATALAITRPRRWLQLWRGVVAEVAAERLDAQP
AFVPEGRSEAENRFLHMGRTMREDMEVVVERLKPLFPEEFNVVHTYAESYHEHFATHLCT
LAQFELCERDTYLLLLWVQNFYPNDILNSPKLAQELQGIRLGSLLPPKQIRLLEAVFLSN
EVTNVKQLMTRALELESQRWAQDVAPQSLDGRRHSELAIDILQIISQGQTKAENITSDVG
MQIKQLLLVELAALLRSYQRVFDEFLEKSKLLRNYRVNIIANINNCLSFRTSVEQRWQIP
QDSLNRLVEPLKDLKAHGFDTLLQSLFSDLKPLFKKFTQTRWAKPVETLEEIITTVSVSL
PEFSELQDCFREELMEAVHLHLVKEYIIRLSKRRLVLKTAEQQQQLAKHILANADTIQHF
CTENGSTATWLHAALPTISEIIRLQDPSAIKIEVATYATWYPDFSKGHLNAILAIKGNLP
SSEVRSIRNILDINTGVQELSRPLFSLIKVA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagatggtgactttcttccaagggcttcctggccagcagtctgtgccagggacc
ctggacctccctggaagcccccaaaagccacgttccacatccgaggcagaatcagagacc
tccatgtctgaggcttcctctgaggacctgatgccatctcaggaggctcctgaaggggag
gaggagtctgcgaagaagaaggagaagaaatccaaaggactggccaatatgttcagtgtc
ttcaccaaagggaagaagaaaaaaaaggaccagcccagattatcggatccggaggtgcag
tccaagtccaggccggaggaagatggtccactgcccacagtggaggagctcaaagaggcc
ctggagctcgggcggctggaggtggcgtggcaggtgctggctttggagcggcagctcgag
gctgctgcggcggcaggtggcacgagcgacgaggagctggtgtggcggcagagcaaggtg
gaggcgctgtatgtactgctgcgcgaccaggtgctccgggtgctgcggcggccgctggag
gcggcaccggagcggctgagccaggcgctggcagtggtgtcgcaggaggagttggaagac
cgccgggcgtcccggggacctttggcaacggcactagcaatcacacgcccgcggcgatgg
ctgcagctgtggaggggcgtcgtggcggaggtagcagccgagcgtctggacgcgcagccc
gcctttgtgcccgagggccgctccgaggccgagaacaggttcctgcacatgggccgcacc
atgagggaggacatggaggtggtggtggagcggctgaaaccgctgttccccgaagagttc
aacgttgtgcacacttacgcagagagctaccacgaacacttcgccacccacctgtgcacc
ttggcgcagttcgagctatgtgaaagggacacctacttgctgctcctctgggtgcagaac
ttctaccccaatgatattctgaacagccctaagttggcacaggagctccagggtatcagg
cttgggagcctcctgcccccaaagcagatccgactgctggaggccgtgttcctgtccaat
gaggtgaccaatgtgaagcagctcatgacccgggctttggagctagagtctcagcgctgg
gcccaggatgtggctccccagagcctggatggccgccgtcacagtgaactggccatcgac
attctccagatcatttcacaaggccagaccaaggctgagaacatcacttccgatgtgggg
atgcagattaagcagttgctactggtggagctggctgcgctactgaggagctaccagcgt
gtctttgatgagtttctagagaaaagcaaactgctgagaaattatagagtcaacatcatc
gccaacatcaacaactgcctgtccttccggacttctgtggaacagaggtggcagatacct
caggattctctgaatcgtctggtggagcctttgaaagacctcaaggctcacggcttcgac
accctgctccagagcctattttcagacctgaagccactgtttaagaagttcacacagacc
cgctgggcaaagccagttgagaccctggaggaaatcatcactactgtgagcgtcagcctg
cccgaattctcagagctgcaggactgtttccgggaggagctcatggaggcagtgcacctg
cacctggtaaaggaatacatcatccggctcagcaaacggcgcctggtcctcaagaccgca
gagcagcagcagcagctggcaaagcacatcctcgccaatgcggacaccattcagcacttc
tgcactgagaatggctccactgcaacctggctgcacgctgccctccctacgatctctgag
attattcgcctgcaagatcccagtgccatcaagatcgaggtggccacatatgccacttgg
taccccgacttcagcaaaggccacctgaacgccatcctggccatcaagggcaatctacca
agcagtgaagtcaggagcatccggaacatactggacatcaacacaggagtgcaggagcta
tccaggcccctgttctcacttataaaagttgcttag

DBGET integrated database retrieval system